Fermented Food Database
This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.
The total number entries retrieved from this search are 841| FMDB_ID | PubMed ID | Reference | Title | Peptide_Sequence | Sequence | Length of peptide | Food_Matrix | Protein | pH | Temperature | Incubation Time | Activity | Experiment | Model | Assay for Activity Measurement | Culture | Hydrolysis | Method of analysis | M_Z ratio | Mass | IC50 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| FMDB28 | 27435541 | NA | NA | IPP | IPP | 3 | Fermented cow Milk or dahi (2.5% skim Milk +2.5%Casein) | NA | NA | 37C | 24h | Cholestrol-lowering | In vitro | Hypercholesterolemic mice | NA | Lactobacillus helveticus strains KHI1 | NA | UPLC-MS/MS. | NA | NA | NA |
| FMDB29 | 27435541 | NA | NA | VPP | VPP | 3 | Fermented cow Milk or dahi (2.5% skim Milk +2.5%Casein) | NA | NA | 37C | 24h | Cholestrol-lowering | In vitro | Hypercholesterolemic mice | NA | Lactobacillus helveticus strains KHI1 | NA | UPLC-MS/MS. | NA | NA | NA |
| FMDB30 | 17430184 | NA | NA | ARHPHPHLSFM | ARHPHPHLSFM | 11 | Skim Milk | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus delbrueckii subsp.bulgaricus IFO13953 | proteinase | NA | NA | NA | NA |
| FMDB31 | 25222748 | NA | NA | DVWY | DVWY | 4 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 582.5 | 0.69±0.04 mM |
| FMDB32 | 25222748 | NA | NA | FDART | FDART | 5 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 609.6 | 1.9±0.1 mM |
| FMDB33 | 25222748 | NA | NA | FQ | FQ | 2 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 294.2 | 7.4±0.6 mM |
| FMDB34 | 25222748 | NA | NA | VAE | VAE | 3 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 318 | 55.9±1.9 mM |
| FMDB35 | 25222748 | NA | NA | VVG | VVG | 3 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 274.2 | 39.6±5.7 mM |
| FMDB36 | 25222748 | NA | NA | WTFR | WTFR | 4 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 609.5 | 6.7±0.5 mM |
| FMDB64 | 10966406 | NA | NA | LNVPGEIVE | LNVPGEIVE | 9 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 969.5 | 300.1umol/l |
| FMDB65 | 10966406 | NA | NA | NIPPLTQTPV | NIPPLTQTPV | 10 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 1079.6 | 173.3 umol/l |
| FMDB66 | 10966406 | NA | NA | IPPLTQTPV | IPPLTQTPV | 9 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 965.5 | NA |
| FMDB67 | 10966406 | NA | NA | PPLTQTPV | PPLTQTPV | 8 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 852.4 | NA |
| FMDB68 | 10966406 | NA | NA | NVPGEIVE | NVPGEIVE | 8 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 856.4 | NA |
| FMDB69 | 10966406 | NA | NA | NVPGEIVE | NVPGEIVE | 8 | UHT skim Milk | β-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 856.4 | NA |
| FMDB70 | 10966406 | NA | NA | DKIHPF | DKIHPF | 6 | UHT skim Milk | β-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 755.4 | 256.8umol/l |
| FMDB71 | 10966406 | NA | NA | KVLPVPE | KVLPVPE | 7 | UHT skim Milk | β-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 780.1 | NA |
| FMDB72 | 10966406 | NA | NA | VIGSPPEIN | VIGSPPEIN | 9 | UHT skim Milk | k-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 996.5 | >1000umol/l |
| FMDB73 | 10966406 | NA | NA | SPPEIN | SPPEIN | 6 | UHT skim Milk | k-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 655.7 | NA |
| FMDB77 | 26877633 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Skimmed Milk | β-Casein | NA | 37C | 24h | Ace-inhibitory | In vitro | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 941.0134+2 | NA | NA |
| FMDB78 | 26877633 | NA | NA | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | Skimmed Milk | β-Casein | NA | 37C | 24h | Ace-inhibitory | In vitro | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 850.9726+2 | NA | NA |
| FMDB84 | 26877633 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Skimmed Milk | β-Casein | NA | 37C | 24h | Ace-inhibitory | In vitro | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 576.3378+2 | NA | NA |
| FMDB102 | 24135669 | NA | NA | LVYPFP | LVYPFP | 6 | Skimmed Milk | β-Casein | 5.82 | 37C | 24h | Ace-inhibitory | In vitro | NA | NA | Bifidobacterium. bifidum MF20/5 | proteases | LC-MS | NA | 735.41 | 132uM |
| FMDB103 | 24135669 | NA | NA | VLPVPQK | VLPVPQK | 7 | Skimmed Milk | β-Casein | 5.82 | 37C | 24h | Antioxidant | In vitro | NA | NA | Bifidobacterium. bifidum MF20/5 | proteases | LC-MS | NA | NA | NA |
| FMDB115 | 26996626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1151.8 | NA | NA |
| FMDB116 | 26996626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1151.8 | NA | NA |
| FMDB117 | 26996626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1151.8 | NA | NA |
| FMDB118 | 26996626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1151.8 | NA | NA |
| FMDB178 | NA | pan05 | Antihypertensive peptides from skimmed Milk hydrolysate digested by cell-free extract of Lactobacillus helveticus JCM1004 | VPP | VPP | 3 | Skimmed Milk | β-Casein &k Casein | 6.5-7.0 | 37c | 20h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substarte | Lactobacillus helveticus JCM1004 | proteinase and peptidase | RPHPLC and protein sequencer | NA | NA | 9.13 ± 0.21 uM |
| FMDB179 | NA | pan05 | NA | IPP | IPP | 3 | Skimmed Milk | β-Casein &k Casein | 6.5-7.0 | 37c | 20h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substarte | Lactobacillus helveticus JCM1004 | proteinase and peptidase | RPHPLC and protein sequencer | NA | NA | 5.15 ± 0.17 UM |
| FMDB189 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | KVLPVPQ | KVLPVPQ | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive;Antioxidant | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | 19mg/ml |
| FMDB190 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | VPYPQR | VPYPQR | 6 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Antioxidant;Anti-hypertensive | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB194 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | PVRGLHP | PVRGLHP | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Antioxidant | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | 19mg/ml |
| FMDB203 | NA | quan08 | Heat treatment resulted in an increase in oral viscosity Angiotensin Iconverting enzyme inhibitory peptides in skim Milk fermented with Lactobacillus helveticus 130B4 from camel Milk in Inner Mongolia, China | AIPPKKNQD | AIPPKKNQD | 9 | Skimmed Milk | k-Casein | 4.6 | 37 C | 72h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactobacillus helveticus 130B4 | NA | LC-ESI-MS/MS | NA | NA | 19.9Umol/l |
| FMDB204 | NA | pan10 | Optimization of sour Milk fermentation for the production of ACE-inhibitory peptides and purification of a novel peptide from Whey protein hydrolysate | RLSFNP | RLSFNP | 6 | Whey protein | Bovine Beta lactoglobulin | 7.5 | 39C | 20h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lb. helveticus LB10 | proteinase and peptidase | RPHLC &triple-quadruple mas spectrometer ESI-MS/MS | NA | 732.84Da | 177.39 μm. |
| FMDB337 | 16476172 | NA | NA | WLAHK | WLAHK | 5 | goat Whey | Alpha lactoglobulin | NA | NA | NA | Ace-inhibitory | In vitro | NA | NA | Can parapsilosis and Lb paracasei | protease | NA | NA | NA | NA |
| FMDB338 | 21787916 | NA | NA | YQEPVLGPVRGPFPI | YQEPVLGPVRGPFPI | 15 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 835.0 (+2) | 1668.04 | 5.3 ± 0.10ug/ml |
| FMDB339 | 21787916 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 941.4 (+2) | 1880.28 | 5.3 ± 0.10ug/ml |
| FMDB340 | 21787916 | NA | NA | EVLNENLLRF | EVLNENLLRF | 10 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 624 (+2) | 1236.82 | 5.3 ± 0.10ug/ml |
| FMDB341 | 21787916 | NA | NA | FVAPFPEVFGK | FVAPFPEVFGK | 11 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 619.4 (+2) | 1245.86 | 5.3 ± 0.10ug/ml |
| FMDB342 | 21787916 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 941.4 (+2) | 1880.28 | 10.4 ± 0.40 ug/ml |
| FMDB343 | 21787916 | NA | NA | RPKHPIKHQGLPQEV | RPKHPIKHQGLPQEV | 15 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 945.2 (+2) | 1893.38 | 10.4 ± 0.40 ug/ml |
| FMDB344 | 21787916 | NA | NA | RPKHPIKHQGLPQEVLNENLLR | RPKHPIKHQGLPQEVLNENLLR | 22 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 922.3 (+2) | 2763.87 | 10.4 ± 0.40 ug/ml |
| FMDB345 | 21787916 | NA | NA | FVAPFPEVFGK | FVAPFPEVFGK | 11 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 619.5 (+2) | 1236.9 | 10.4 ± 0.40 ug/ml |
| FMDB346 | 21787916 | NA | NA | EVLNENLLRF | EVLNENLLRF | 10 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 624.2 (+2) | 1246.22 | 10.4 ± 0.40 ug/ml |
| FMDB347 | 21787916 | NA | NA | YQEPVLGPVRGPF | YQEPVLGPVRGPF | 13 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 729.9 (+2) | 1457.8 | 10.4 ± 0.40 ug/ml |
| FMDB348 | 21787916 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 941.7 (+2) | 1881.46 | 10.4 ± 0.40 ug/ml |
| FMDB349 | 22901481 | NA | NA | DDQNPH | DDQNPH | 6 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 362.9 (+2) | 723.9 | 0.076 ±004ug/ml |
| FMDB350 | 22901481 | NA | NA | LDDDLTDDI | LDDDLTDDI | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 517.4(+2) | 1032.8 | 0.076 ±004ug/ml |
| FMDB351 | 22901481 | NA | NA | YPSYGL | YPSYGL | 6 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 350.3(+2) | 698.6 | 0.076 ±004ug/ml |
| FMDB352 | 22901481 | NA | NA | HPHPHLSFMAIPP | HPHPHLSFMAIPP | 13 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 740.5(+2) | 1479 | 0.076 ±004ug/ml |
| FMDB353 | 22901481 | NA | NA | YDTQAIVQ | YDTQAIVQ | 8 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 518.8(+2) | 1035.7 | 0.076 ±004ug/ml |
| FMDB354 | 22901481 | NA | NA | DDDLTDDIMCV | DDDLTDDIMCV | 11 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 462.3(+3) | 1386.8 | 0.076 ±004ug/ml |
| FMDB355 | 22901481 | NA | NA | YPSYG | YPSYG | 5 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 586.7(+1) | 585.9 | 0.076 ±004ug/ml |
| FMDB356 | 22901481 | NA | NA | AESIS | AESIS | 5 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | αS1-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 506.9(+3) | 505.9 | NA |
| FMDB357 | 22901481 | NA | NA | SITRINK | SITRINK | 7 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 416.1(+2) | 830.1 | NA |
| FMDB358 | 22901481 | NA | NA | HIQKEDVPS | HIQKEDVPS | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | αS1-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 526.7(+2) | 1051.4 | NA |
| FMDB359 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 453(+2) | 904.1 | NA |
| FMDB360 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 453.2(+2) | 904.3 | NA |
| FMDB361 | 22901481 | NA | NA | NAVPITPTLN | NAVPITPTLN | 10 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | αS2-CN | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 520.2(+2) | 1038.4 | NA |
| FMDB362 | 22901481 | NA | NA | SLPQNIPPL | SLPQNIPPL | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 489.6(+2) | 977.1 | NA |
| FMDB363 | 22901481 | NA | NA | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 859.4(+2) | 1716.9 | NA |
| FMDB364 | 22901481 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 576.2(+2) | 1150.4 | NA |
| FMDB365 | 22901481 | NA | NA | SLPQNIPPL | SLPQNIPPL | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 489.7(+2) | 977.2 | NA |
| FMDB366 | 22901481 | NA | NA | YIPIQYVLS | YIPIQYVLS | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 548.2(+2) | 1094.4 | NA |
| FMDB367 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 453.5(+2) | 904.4 | 0.034 ± 0.002 μg/mL |
| FMDB368 | 22901481 | NA | NA | PEINTVQVTSTAV | PEINTVQVTSTAV | 13 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 453.2(+3) | 1356.7 | 0.034 ± 0.002 μg/mL |
| FMDB369 | 22901481 | NA | NA | GYLAVA | GYLAVA | 6 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | Serotransferrin | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 198.3(+3) | 591.8 | 0.034 ± 0.002 μg/mL |
| FMDB370 | 22901481 | NA | NA | DVENLHLPLPLL | DVENLHLPLPLL | 12 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 686.6(+2) | 1371.53 | 0.041 ± 0.003 ug/ml |
| FMDB371 | 22901481 | NA | NA | YPSYGL | YPSYGL | 6 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 350.2(+2) | 698.6 | 0.041 ± 0.003 ug/ml |
| FMDB372 | 22901481 | NA | NA | ENGEC | ENGEC | 5 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-lactoglobulin | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 550.9(+3) | 549.8 | 0.041 ± 0.003 ug/ml |
| FMDB373 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 453.1(+2) | 904.2 | 0.084 ± 0.003 μg/mL |
| FMDB374 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 453.1(+2) | 904.2 | NA |
| FMDB375 | 22901481 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 576.3(+2) | 1150.5 | NA |
| FMDB376 | 22901481 | NA | NA | TDDIMCVK | TDDIMCVK | 8 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 922.4(+1) | 922.4 | NA |
| FMDB377 | 24135669 | NA | NA | LVYPFP | LVYPFP | 6 | probiotic femented Milk | β-Casein | 6.67 | 37C | 24h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Bifidobacterium bifidum MF 20/5 | proteinase and peptidase | LCMS | NA | NA | 132uM |
| FMDB378 | 24135669 | NA | NA | LPLP | LPLP | 4 | probiotic femented Milk | β-Casein | 6.67 | 37C | 24h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Bifidobacterium bifidum MF 20/5 | proteinase and peptidase | LCMS | NA | NA | 750uM |
| FMDB379 | 24135669;11170591 | NA | NA | VLPVPQK | VLPVPQK | 7 | probiotic femented Milk | β-Casein | 6.67 | 37C | 24h | Ace-inhibitory;Antioxidant | In vitro | NA | spectrophotometeric assay using HHL as substrate | Bifidobacterium bifidum MF 20/5 | proteinase and peptidase | LCMS | NA | NA | NA |
| FMDB380 | 24135669 | NA | NA | IPP | IPP | 3 | NA | NA | 4.6 | 37C | 24h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | L. helveticus DSM13137 | proteinase and peptidase | LCMS | NA | NA | NA |
| FMDB381 | 24135669 | NA | NA | VPP | VPP | 3 | NA | NA | 4.6 | 37C | 24h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | L. helveticus DSM13137 | proteinase and peptidase | LCMS | NA | NA | NA |
| FMDB705 | 22156436 | NA | NA | MAPAAVAAAEAGSK | MAPAAVAAAEAGSK | 14 | Whole wheat flour | NA | 3.40 ± 0.03 | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1243.623 | NA |
| FMDB706 | 22156436 | NA | NA | DNIPIVIR | DNIPIVIR | 8 | Whole wheat flour | NA | 3.40 ± 0.03 | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS48 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 938.5549 | NA |
| FMDB707 | 22156436 | NA | NA | AIAGAGVLSGYDQLQILFFGK | AIAGAGVLSGYDQLQILFFGK | 21 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS49 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2167.1677 | NA |
| FMDB708 | 22156436 | NA | NA | GNQEKVLELVQR | GNQEKVLELVQR | 12 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS50 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1411.7783 | NA |
| FMDB709 | 22156436 | NA | NA | PAGSAAGAAP | PAGSAAGAAP | 10 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS51 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 769.8311 | NA |
| FMDB710 | 22156436 | NA | NA | EALEAMFL | EALEAMFL | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS52 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 924.1021 | NA |
| FMDB711 | 22156436 | NA | NA | AAGAAAAARSAGQCGR | AAGAAAAARSAGQCGR | 16 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS53 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1387.6738 | NA |
| FMDB712 | 22156436 | NA | NA | ITFAAYRR | ITFAAYRR | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS54 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 998.1621 | NA |
| FMDB713 | 22156436 | NA | NA | HPVPPKKK | HPVPPKKK | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS55 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 912.2177 | NA |
| FMDB714 | 22156436 | NA | NA | VFVDEGLEVLGWRPVPFNVSVVGRNAK | VFVDEGLEVLGWRPVPFNVSVVGRNAK | 27 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS56 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2982.608 | NA |
| FMDB715 | 22156436 | NA | NA | RLSLPAGAPVTVAVSP | RLSLPAGAPVTVAVSP | 16 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS57 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1535.8101 | NA |
| FMDB716 | 22156436 | NA | NA | NANGELCPNNMCCSQWGYCGLGSEFCGNGCQSGACCPEK | NANGELCPNNMCCSQWGYCGLGSEFCGNGCQSGACCPEK | 39 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS58 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 4033.4843 | NA |
| FMDB717 | 22156436 | NA | NA | LCPVHRAADL | LCPVHRAADL | 10 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS59 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1095.3231 | NA |
| FMDB718 | 22156436 | NA | NA | PAEMVAAALDR | PAEMVAAALDR | 11 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS60 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1484.7511 | NA |
| FMDB719 | 22156436 | NA | NA | KVALMSAGSMH | KVALMSAGSMH | 11 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS61 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1131.2679 | NA |
| FMDB720 | 22156436 | NA | NA | DLADIPQQQRLMAGLALVVATVIFLK | DLADIPQQQRLMAGLALVVATVIFLK | 26 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS62 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2822.6092 | NA |
| FMDB721 | 22156436 | NA | NA | KNGSIFNSPSATAATIIHGHNYSGLAYLDFVTSK | KNGSIFNSPSATAATIIHGHNYSGLAYLDFVTSK | 34 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS63 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 3580.795 | NA |
| FMDB722 | 22156436 | NA | NA | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK | 53 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS64 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 5338.5201 | NA |
| FMDB723 | 22156436 | NA | NA | YEWEPTVPNFDVAKDVTDM | YEWEPTVPNFDVAKDVTDM | 19 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS65 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2255.0093 | NA |
| FMDB724 | 22156436 | NA | NA | GVSNAAVVAGGH | GVSNAAVVAGGH | 12 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS66 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1037.5254 | NA |
| FMDB725 | 22156436 | NA | NA | DAQEFKR | DAQEFKR | 7 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS67 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 892.4403 | NA |
| FMDB726 | 22156436 | NA | NA | PPGPGPGPPPPPGAAGRGGGG | PPGPGPGPPPPPGAAGRGGGG | 21 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS68 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1704.8721 | NA |
| FMDB727 | 22156436 | NA | NA | HKEMQAIFDVYIMFIN | HKEMQAIFDVYIMFIN | 16 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS69 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2000.3734 | NA |
| FMDB728 | 22156436 | NA | NA | TGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR | TGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR | 57 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS70 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 5124.5196 | NA |
| FMDB729 | 22156436 | NA | NA | DTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR | DTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR | 52 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS71 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 4921.2889 | NA |
| FMDB730 | NA | padghan16 | Production of Angiotensin-I-Converting-Enzyme-Inhibitory Peptides in Fermented Milks (Lassi) Fermented by Lactobacillus acidophillus with Consideration of Incubation Period and Simmering Treatment | LPYPYYAKPA | LPYPYYAKPA | 10 | fermented Milk ( lassi) | k-Casein | 4.6 | 37C | 10h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1181.66 | NA |
| FMDB756 | NA | NA | MAPKHKEMPFPKYPVEPF | MAPKHKEMPFPKYPVEPF | 18 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory;Cytomodulatory | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 2172.25 | NA | |
| FMDB757 | NA | NA | MPFPKYPVEPF | MPFPKYPVEPF | 11 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1350.78 | NA | |
| FMDB762 | NA | NA | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1717.07 | NA | |
| FMDB767 | NA | NA | SWMHQPPQPLPPTVMFPPQSVLSL | SWMHQPPQPLPPTVMFPPQSVLSL | 24 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 2713.48 | NA | |
| FMDB770 | NA | NA | WMHQPPQPLPPTVMFPPQSVLSL | WMHQPPQPLPPTVMFPPQSVLSL | 23 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 2626.67 | NA | |
| FMDB774 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory;Antioxidant;Immunomodulatory;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1880.2 | NA | |
| FMDB775 | 11410001 | NA | NA | HHL | HHL | 3 | Korean Fermented soyabean paste | NA | NA | NA | NA | Ace-inhibitory | In vitro and In vivo | Spontaneously Hypertensive Rats | spectrophotometric assay using HHL as substrate | NA | NA | RPHPLC and Edman degradation | NA | 405 da | 2.2 ug/ml |
| FMDB780 | NA | papdimitriou07 | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | DKIHPFAQ | DKIHPFAQ | 8 | sheep Milk Yogurt | β-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | 257uM |
| FMDB781 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | TQTPVVVP | TQTPVVVP | 8 | sheep Milk Yogurt | β-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | 173uM | |
| FMDB782 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | KAVPQ | KAVPQ | 5 | fermented sheep Milk | β-Casein | NA | 37C | 18h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | 39uM | |
| FMDB783 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | RPKHPIKH YQKA | RPKHPIKH YQKA | 13 | fermented sheep Milk | αS1-Casein | NA | 37C | 18h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus Y10.13 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB784 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | RPKHPIKH | RPKHPIKH | 8 | sheep Milk Yogurt | αS1-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | 40.3uM | |
| FMDB785 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | SQPK YQEP | SQPK YQEP | 9 | sheep Milk Yogurt | β-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB786 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | NQFLPYPY | NQFLPYPY | 8 | sheep Milk Yogurt | k-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB787 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | TQTPVVVP | TQTPVVVP | 8 | sheep Milk Yogurt | β-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB788 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | YPVEPFTE | YPVEPFTE | 8 | sheep Milk Yogurt | β-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | 0.37mg/ml | |
| FMDB789 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | GVPKVK | GVPKVK | 6 | fermented sheep Milk | β-Casein | NA | 37C | 18h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB790 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | GVPKVKE | GVPKVKE | 7 | fermented sheep Milk | β-Casein | NA | 37C | 18h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB791 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | GVPKVKE | GVPKVKE | 7 | fermented sheep Milk | β-Casein | NA | 38C | 18h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB792 | 25829629 | NA | NA | TYKEE | TYKEE | 5 | skim Milk Yogurt | αS2-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B94 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 12.41+/-0.46ug/ml |
| FMDB793 | 25829629 | NA | NA | IPP | IPP | 3 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B95 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 11.6uM |
| FMDB794 | 25829629 | NA | NA | IPP | IPP | 3 | skim Milk Yogurt | k-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B96 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 11.6uM |
| FMDB795 | 25829629 | NA | NA | YQQPVL | YQQPVL | 6 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B96 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 6.09+/-0.46ug/ml |
| FMDB796 | 25829629 | NA | NA | RINKK | RINKK | 5 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B97 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 12.05+/-0.93ug/ml |
| FMDB797 | 25829629 | NA | NA | SLPQN | SLPQN | 5 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B98 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 5.29±0.55ug/ml |
| FMDB798 | 25829629 | NA | NA | VPP | VPP | 3 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B99 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 8.4uM |
| FMDB799 | 25829629 | NA | NA | ARHPH | ARHPH | 5 | skim Milk Yogurt | k-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B100 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 9.64±3.67ug/ml |
| FMDB802 | 16162521 | NA | NA | KIHPFAQAQ | KIHPFAQAQ | 9 | caprine kefir | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1038.4 ± 0.02 | 132.6 ± 14.1 µM |
| FMDB806 | 16162521 | NA | NA | GVPKVKETMVPKH | GVPKVKETMVPKH | 13 | caprine kefir | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1448.5 ± 0.08 | 223.2 ± 21.3 |
| FMDB809 | 16162521 | NA | NA | KFAWPQ | KFAWPQ | 6 | caprine kefir | αS2-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 775.5 ± 0.05 | 177.1 ± 14.9 |
| FMDB813 | 16162521 | NA | NA | ENLLRF | ENLLRF | 6 | caprine kefir | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 790.4 ± 0.06 | 82.4 ± 8.9 |
| FMDB814 | 16162521 | NA | NA | PYVRYL | PYVRYL | 6 | caprine kefir | αS2-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 809.4 ± 0.07 | 2.4 ± 0.2 |
| FMDB815 | 16162521 | NA | NA | LVYPFTGPIPN | LVYPFTGPIPN | 11 | caprine kefir | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1216.5 ± 0.01 | 27.9 ± 2.3 |
| FMDB816 | NA | ronquillo12 | Antithrombotic and angiotensin-converting enzyme inhibitory properties of peptides released from bovine Casein by Lactobacillus casei Shirota | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein medium | β-Casein | NA | 37c | 42h | Antithrombotic | In vitro | NA | Thrombin inhibition assay | Lactobacillus caseiShirota and Streptococcus thermophilus | NA | MALDI-TOF/TOF MS | NA | 1.88Kda | IER value of 0.14%/peptide concentration (mg mL1 |
| FMDB817 | NA | Antithrombotic and angiotensin-converting enzyme inhibitory properties of peptides released from bovine Casein by Lactobacillus casei Shirota | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein medium | β-Casein | NA | 34c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactobacillus caseiShirota and Streptococcus thermophilus | NA | MALDI-TOF/TOF MS | NA | NA | NA | |
| FMDB842 | 19994857 | NA | NA | AW | AW | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 10ug/ml |
| FMDB843 | 19994857 | NA | NA | GW | GW | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 30ug/ml |
| FMDB844 | 19994857 | NA | NA | AY | AY | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 48ug/ml |
| FMDB845 | 19994857 | NA | NA | SY | SY | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 67ug/ml |
| FMDB846 | 19994857 | NA | NA | GY | GY | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 67ug/ml |
| FMDB847 | 19994857 | NA | NA | AF | AF | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 190ug/ml |
| FMDB848 | 19994857 | NA | NA | VP | VP | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 480ug/ml |
| FMDB849 | 19994857 | NA | NA | AI | AI | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 690ug/ml |
| FMDB850 | 19994857 | NA | NA | VG | VG | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 1100ug/ml |
| FMDB851 | 18160180 | NA | NA | AF | AF | 2 | salt free soy sauce | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | NA | A. sojae | peptidase | Two step RPHPLC | NA | NA | 165.3uM |
| FMDB852 | 18160180 | NA | NA | IF | IF | 2 | salt free soy sauce | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | NA | A. sojae | peptidase | Two step RPHPLC | NA | NA | 65.8uM |
| FMDB858 | NA | kuba05 | Production of angiotensin I-converting enzyme inhibitory peptides from soybean protein with Monascus purpureus acid proteinase | LAIPVNKP | LAIPVNKP | 8 | soybean proteins | b-conGlycinin | 3.3 | 37c | 10h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using pig pulmonary ACE and hippuryl-L-histidyl-L-leucine substrate | 100 units acid proteinase from M. purpureus No. 3403 | proteinase | RPHLC and automated Edman degradation with a gas/liquid-phase protein sequencer | NA | NA | 70uM |
| FMDB859 | NA | kuba05 | Production of angiotensin I-converting enzyme inhibitory peptides from soybean protein with Monascus purpureus acid proteinase | LPHF | LPHF | 4 | soybean proteins | b-conGlycinin | 3.3 | 37c | 10h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using pig pulmonary ACE and hippuryl-L-histidyl-L-leucine substrate | 100 units acid proteinase from M. purpureus No. 3403 | proteinase | RPHLC and automated Edman degradation with a gas/liquid-phase protein sequencer | NA | NA | 670uM |
| FMDB860 | NA | kuba05 | Production of angiotensin I-converting enzyme inhibitory peptides from soybean protein with Monascus purpureus acid proteinase | SPYP | SPYP | 4 | soybean proteins | Glycinin | 3.3 | 37c | 10h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using pig pulmonary ACE and hippuryl-L-histidyl-L-leucine substrate | 100 units acid proteinase from M. purpureus No. 3403 | proteinase | RPHLC and automated Edman degradation with a gas/liquid-phase protein sequencer | NA | NA | 850uM |
| FMDB861 | NA | kuba05 | Production of angiotensin I-converting enzyme inhibitory peptides from soybean protein with Monascus purpureus acid proteinase | WL | WL | 2 | soybean proteins | Glycinin | 3.3 | 37c | 10h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using pig pulmonary ACE and hippuryl-L-histidyl-L-leucine substrate | 100 units acid proteinase from M. purpureus No. 3403 | proteinase | RPHLC and automated Edman degradation with a gas/liquid-phase protein sequencer | NA | NA | 65uM |
| FMDB862 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1140.7g/mol | 0.25mg/ml |
| FMDB863 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIK | RPKHPIK | 7 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 877g/mol | 0.25mg/ml |
| FMDB864 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPI | RPKHPI | 6 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 745.4g/mol | 0.25mg/ml |
| FMDB865 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | DKIHPF | DKIHPF | 6 | WSE of Cheddar cheese | β-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 755.4g/mol | 0.14mg/ml |
| FMDB866 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1053.3g/mol | 0.11mg/ml |
| FMDB867 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | KKYKVPQLE | KKYKVPQLE | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1132.4g/mol | 0.11mg/ml |
| FMDB868 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | WSE of Cheddar cheese | β-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1881.1g/mol | 0.14mg/ml |
| FMDB869 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1140.7g/mol | 0.18mg/ml |
| FMDB870 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIK | RPKHPIK | 7 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 877g/mol | 0.18mg/ml |
| FMDB871 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPI | RPKHPI | 6 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 745.4g/mol | 0.18mg/ml |
| FMDB872 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | DKIHPF | DKIHPF | 6 | WSE of Cheddar cheese | β-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 755.4g/mol | 0.12mg/ml |
| FMDB873 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1053.3g/mol | 0.09mg/ml |
| FMDB874 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | KKYKVPQLE | KKYKVPQLE | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1132.4g/mol | 0.09mg/ml |
| FMDB875 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | WSE of Cheddar cheese | β-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1881.1g/mol | 0.17mg/ml |
| FMDB876 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1140.7g/mol | 0.20mg/ml |
| FMDB877 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIK | RPKHPIK | 7 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 877g/mol | 0.20mg/ml |
| FMDB878 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPI | RPKHPI | 6 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 745.4g/mol | 0.20mg/ml |
| FMDB879 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | DKIHPF | DKIHPF | 6 | WSE of Cheddar cheese | β-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 755.4g/mol | 0.16mg/ml |
| FMDB880 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1053.3g/mol | 0.12mg/ml |
| FMDB881 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | KKYKVPQLE | KKYKVPQLE | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1132.4g/mol | 0.12mg/ml |
| FMDB882 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | WSE of Cheddar cheese | β-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1881.1g/mol | 0.14mg/ml |
| FMDB883 | 16517684 | NA | NA | IKHQGLPQE | IKHQGLPQE | 9 | sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Anti-microbial against Enterobacter sakazakii ATCC 12868;Escherichia coli DPC5063 | In vitro | NA | well diffusion assay | L. acidophilus DPC6026 | proteinase | MALDI-TOF-MS | 1049.177 | NA | MIC;0.05mM |
| FMDB884 | PMD16517684 | NA | NA | VLNENLLR | VLNENLLR | 8 | sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Anti-microbial against Enterobacter sakazakii ATCC 12868;Escherichia coli DPC5063 | In vitro | NA | well diffusion assay | L. acidophilus DPC6026 | proteinase | MALDI-TOF-MS | 970.119 | NA | MIC;0.22mM |
| FMDB885 | PMD16517684 | NA | NA | SDIPNPI G SENSEK | SDIPNPI G SENSEK | 16 | sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Anti-microbial against Enterobacter sakazakii ATCC 12868;Escherichia coli DPC5063 | In vitro | NA | well diffusion assay | L. acidophilus DPC6026 | proteinase | MALDI-TOF-MS | 1486.7 | NA | MIC;1.0mM |
| FMDB886 | 22642665 | NA | NA | IKHQGLPQE | IKHQGLPQE | 9 | sodium Caseinate | αS1-Casein | NA | 37c | 17h | Anti-microbial against Cronobacter sakazakii DPC 6440 | In vitro | NA | 96 well antimicrobial assay | Bacillus cereus | proteases | MALDI-TOF-MS | NA | 1049 Da | NA |
| FMDB887 | 22642665 | NA | NA | VLNENLLR | VLNENLLR | 8 | sodium Caseinate | αS1-Casein | NA | 37c | 17h | Anti-microbial against Cronobacter sakazakii DPC 6440 | In vitro | NA | 97 well antimicrobial assay | Bacillus cereus | proteases | MALDI-TOF-MS | NA | 970Da | NA |
| FMDB888 | 22642665 | NA | NA | IKHQGLPQE | IKHQGLPQE | 9 | sodium Caseinate | αS1-Casein | NA | 37c | 17h | Anti-microbial against Cronobacter sakazakii DPC 6440 | In vitro | NA | 98 well antimicrobial assay | Bacillus thuringiensis | proteases | MALDI-TOF-MS | NA | 1049 Da | NA |
| FMDB889 | 22642665 | NA | NA | VLNENLLR | VLNENLLR | 8 | sodium Caseinate | αS1-Casein | NA | 37c | 17h | Anti-microbial against Cronobacter sakazakii DPC 6440 | In vitro | NA | 99 well antimicrobial assay | Bacillus thuringiensis | proteases | MALDI-TOF-MS | NA | 970 Da | NA |
| FMDB890 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | VPKVKET | VPKVKET | 7 | raw Ewe's mik , Manchego cheese | β-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 400.7 +2 | 800.3 | NA |
| FMDB891 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | LKKISQ | LKKISQ | 6 | raw Ewe's mik , Manchego cheese | αS2-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 358.7 +2 | 715.4 | NA |
| FMDB892 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | VPKVKE | VPKVKE | 6 | raw Ewe's mik , Manchego cheese | β-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 350.2+ 2 | 698.5 | NA |
| FMDB893 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | DKIHP | DKIHP | 5 | raw Ewe's mik , Manchego cheese | β-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 305.1 +2 | 608.3 | NA |
| FMDB894 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | KQMK | KQMK | 4 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 268.1+ 2 | 534.4 | NA |
| FMDB895 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | KKYNVPQ | KKYNVPQ | 7 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 438.7 +2 | 875.4 | NA |
| FMDB896 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | VPSERY | VPSERY | 6 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 375.7 +2 | 749.4 | NA |
| FMDB897 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | FPE | FPE | 3 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 392.1 +1 | 391.1 | NA |
| FMDB898 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | DVPSERY | DVPSERY | 7 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 433.1+ 2 | 864.4 | NA |
| FMDB899 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | REQEEL | REQEEL | 6 | raw Ewe's mik , Manchego cheese | β-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 402.1 +2 | 802.4 | NA |
| FMDB900 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | IPY | IPY | 3 | raw Ewe's mik , Manchego cheese | αS2-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 392.1 +1 | 391.1 | NA |
| FMDB901 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | AWPQ | AWPQ | 4 | raw Ewe's mik , Manchego cheese | αS2-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 501.1+ 1 | 500.1 | NA |
| FMDB902 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | FP | FP | 2 | raw Ewe's mik , Manchego cheese | various Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 263.0+ 1 | 262 | NA |
| FMDB903 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | TQPKTNAIPY | TQPKTNAIPY | 10 | raw Ewe's mik , Manchego cheese | αS2-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 566.7+ 2 | 1131.3 | NA |
| FMDB904 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | DVPSERYLG | DVPSERYLG | 9 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 518.1+ 2 | 1035.3 | NA |
| FMDB905 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | VPSERYL | VPSERYL | 7 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 432.2 +2 | 862.3 | NA |
| FMDB906 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | LEIVPK | LEIVPK | 6 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 349.6+ 2 | 697.3 | NA |
| FMDB907 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | VRYL | VRYL | 4 | raw Ewe's mik , Manchego cheese | αS2-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 275.5 +2 | 549.3 | NA |
| FMDB908 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | VRGPFP | VRGPFP | 6 | raw Ewe's mik , Manchego cheese | β-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 672.4+ 1 | 671.4 | NA |
| FMDB909 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | VVAPFPE | VVAPFPE | 7 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 758.1 +1 | 757.4 | NA |
| FMDB910 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | KKYNVPQL | KKYNVPQL | 8 | raw Ewe's mik , Manchego cheese | αS1-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 495.3+ 2 | 988.4 | NA |
| FMDB911 | NA | ruiz02 | Angiotensin-converting enzyme-inhibitory peptides in Manchego cheeses manufactured with different starter cultures | GPVRGPFP | GPVRGPFP | 8 | raw Ewe's mik , Manchego cheese | β-Casein | NA | NA | 8month aged | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Lactococcus lactis subsp. lactis (80%) and Leuconostoc mesenteroides subsp. dextranicum (20%), | NA | ESI-MS/MS | 413.7 +2 | 825.6 | NA |
| FMDB912 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLP | LHLPLP | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | SHR | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 345.4 +2 | 688.4 | 5.5±0.4uM |
| FMDB913 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLPL | LHLPLPL | 7 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | SHR | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 401.9 +2 | 801.5 | 425±44uM |
| FMDB914 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 2060.0 +1 | 2059.4 | 5.27±0.3uM |
| FMDB915 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFP | VLGPVRGPFP | 10 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 520.0 +2 | 1037.6 | 137±6uM |
| FMDB916 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VRGPFPIIV | VRGPFPIIV | 9 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 499.5 +2 | 996.6 | 599±55uM |
| FMDB917 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFPIIV | VLGPVRGPFPIIV | 13 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 682.7 +2 | 1362.7 | >700uM |
| FMDB918 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LTQTPVVVPPF | LTQTPVVVPPF | 11 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 1197.4 +1 | 1196.6 | >1500uM |
| FMDB919 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VVVPPF | VVVPPF | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5727 | NA | HPLC-MS | 329.3 +2 | 656.3 | >1500uM |
| FMDB920 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLP | LHLPLP | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 345.4 +2 | 688.4 | 5.5±0.4uM |
| FMDB921 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLPL | LHLPLPL | 7 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 401.9 +2 | 801.5 | 425±44uM |
| FMDB922 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 2060.0 +1 | 2059.4 | 5.27±0.3uM |
| FMDB923 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFP | VLGPVRGPFP | 10 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 520.0 +2 | 1037.6 | 137±6uM |
| FMDB924 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VRGPFPIIV | VRGPFPIIV | 9 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 499.5 +2 | 996.6 | 599±55uM |
| FMDB925 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFPIIV | VLGPVRGPFPIIV | 13 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 682.7 +2 | 1362.7 | >700uM |
| FMDB926 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LTQTPVVVPPF | LTQTPVVVPPF | 11 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 1197.4 +1 | 1196.6 | >1500uM |
| FMDB927 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VVVPPF | VVVPPF | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5728 | NA | HPLC-MS | 329.3 +2 | 656.3 | >1500uM |
| FMDB928 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLP | LHLPLP | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 345.4 +2 | 688.4 | 5.5±0.4uM |
| FMDB929 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLPL | LHLPLPL | 7 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 401.9 +2 | 801.5 | 425±44uM |
| FMDB930 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 2060.0 +1 | 2059.4 | 5.27±0.3uM |
| FMDB931 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFP | VLGPVRGPFP | 10 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 520.0 +2 | 1037.6 | 137±6uM |
| FMDB932 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VRGPFPIIV | VRGPFPIIV | 9 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 499.5 +2 | 996.6 | 599±55uM |
| FMDB933 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFPIIV | VLGPVRGPFPIIV | 13 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 682.7 +2 | 1362.7 | >700uM |
| FMDB934 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LTQTPVVVPPF | LTQTPVVVPPF | 11 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 1197.4 +1 | 1196.6 | >1500uM |
| FMDB935 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VVVPPF | VVVPPF | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5826 | NA | HPLC-MS | 329.3 +2 | 656.3 | >1500uM |
| FMDB936 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLP | LHLPLP | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 345.4 +2 | 688.4 | 5.5±0.4uM |
| FMDB937 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LHLPLPL | LHLPLPL | 7 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 401.9 +2 | 801.5 | 425±44uM |
| FMDB938 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 2060.0 +1 | 2059.4 | 5.27±0.3uM |
| FMDB939 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFP | VLGPVRGPFP | 10 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 520.0 +2 | 1037.6 | 137±6uM |
| FMDB940 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VRGPFPIIV | VRGPFPIIV | 9 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 499.5 +2 | 996.6 | 599±55uM |
| FMDB941 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VLGPVRGPFPIIV | VLGPVRGPFPIIV | 13 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 682.7 +2 | 1362.7 | >700uM |
| FMDB942 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | LTQTPVVVPPF | LTQTPVVVPPF | 11 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 1197.4 +1 | 1196.6 | >1500uM |
| FMDB943 | NA | quiros07 | Identification of novel antihypertensive peptides in Milk fermented with Enterococcus faecalis | VVVPPF | VVVPPF | 6 | Reconstituted skim Milk (10% wt/wt) | β-Casein | 4.5 | 37C | 48h | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | Enterococcus faecalis CECT 5827 | NA | HPLC-MS | 329.3 +2 | 656.3 | >1500uM |
| FMDB944 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | SN | SN | 2 | WSE of commercial fermented Milk spain | Various Caseins | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 218.9 | NA |
| FMDB945 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | VPP | VPP | 3 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 311 | 9 μM |
| FMDB946 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | RY | RY | 2 | WSE of commercial fermented Milk spain | Various Caseins | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 337.1 | 10.5 μM |
| FMDB947 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | PQEVL | PQEVL | 5 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 584.4 | NA |
| FMDB948 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | VLNENLL | VLNENLL | 7 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 813.5 | NA |
| FMDB949 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | KFALPQ | KFALPQ | 6 | WSE of commercial fermented Milk spain | αS2-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 702.5 | NA |
| FMDB950 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | IPPL | IPPL | 4 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 438.4 | NA |
| FMDB951 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | SLTLTDVE | SLTLTDVE | 8 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 876.4 | NA |
| FMDB952 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | KYIPIQY | KYIPIQY | 7 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 923.5 | NA |
| FMDB953 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | IPIQY | IPIQY | 5 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 632.4 | NA |
| FMDB954 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | AVRSPAQIL | AVRSPAQIL | 9 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 953.4 | NA |
| FMDB955 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | AVRSPAQILQ | AVRSPAQILQ | 10 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1081.5 | NA |
| FMDB956 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | QWQVLSN | QWQVLSN | 7 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 873.4 | NA |
| FMDB957 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | AIPPKKNQDKTEIPTIN | AIPPKKNQDKTEIPTIN | 17 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1906.8 | NA |
| FMDB958 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | NLLRF | NLLRF | 5 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 661.5 | NA |
| FMDB959 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | FVAPFPE | FVAPFPE | 7 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 805.4 | NA |
| FMDB960 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | FRQFYQL | FRQFYQL | 7 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1000.5 | NA |
| FMDB961 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | KTTMPLW | KTTMPLW | 7 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory;Immunomodulatory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 875.5 | 51 μM |
| FMDB962 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | ENSKKTVD | ENSKKTVD | 8 | WSE of commercial fermented Milk spain | αS2-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 919.4 | NA |
| FMDB963 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | EQQQTEDE | EQQQTEDE | 8 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1005.4 | NA |
| FMDB964 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | LPQNIPPL | LPQNIPPL | 8 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 890.5 | NA |
| FMDB965 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | NIPPLTQTPV | NIPPLTQTPV | 10 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1078.5 | 173.3 μM |
| FMDB966 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | VPPFLQP | VPPFLQP | 7 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 796.5 | 749 μM |
| FMDB967 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | VPPFLQPE | VPPFLQPE | 8 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 925.5 | NA |
| FMDB968 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | FPPQSVL | FPPQSVL | 7 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 786.5 | NA |
| FMDB969 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | KVLPVPQ | KVLPVPQ | 7 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 779.6 | 39 μM |
| FMDB970 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | ILQWQVLSN | ILQWQVLSN | 9 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1100.5 | NA |
| FMDB971 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | VAPFPGVFGK | VAPFPGVFGK | 10 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1089.5 | 140 μM |
| FMDB972 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | VAPFPGVFGK | VAPFPGVFGK | 10 | WSE of commercial fermented Milk spain | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1089.5 | NA |
| FMDB973 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | HLPLPL | HLPLPL | 6 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 688.5 | 41 μM |
| FMDB974 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | HLPLPL | HLPLPL | 6 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 688.5 | NA |
| FMDB975 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | PPQ | PPQ | 3 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 340.2 | NA |
| FMDB976 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | GPVRGPFPII | GPVRGPFPII | 10 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Ace-inhibitory;Immunomodulatory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1051.5 | NA |
| FMDB977 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | GPVRGPFPII | GPVRGPFPII | 10 | WSE of commercial fermented Milk spain | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1051.5 | NA |
| FMDB978 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | NQE | NQE | 3 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 389.2 | NA |
| FMDB979 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | NQE | NQE | 3 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 389.2 | NA |
| FMDB980 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | AKYIPIQYVLSRYPSY | AKYIPIQYVLSRYPSY | 16 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1959.4 | NA |
| FMDB981 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | AKYIPIQYVLSRYPSY | AKYIPIQYVLSRYPSY | 16 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 1959.4 | NA |
| FMDB982 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | IPIQYVL | IPIQYVL | 7 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 844.6 | NA |
| FMDB983 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | IPIQYVL | IPIQYVL | 7 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 844.6 | NA |
| FMDB984 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | PPK | PPK | 3 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 340.2 | NA |
| FMDB985 | NA | ledesma05 | Identification of antioxidant and ACE-inhibitory peptides in fermented Milk | PPK | PPK | 3 | WSE of commercial fermented Milk spain | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | NA | NA | RP-HPLC– tandem mass spectrometry (MS/MS) | NA | 340.2 | NA |
| FMDB990 | NA | vallabha13 | Antihypertensive Peptides Derived from soy Protein by Fermentation | LIVTQ | LIVTQ | 5 | Fermented soy protein (Defatted soya flour) | NA | NA | 37C | 36h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus caseispp. pseudoplantarum | NA | RPHPLC and sequence determination by Edman degradatiojn usng Applied Biosystems 477-A gas phase sequencer | NA | NA | 0.087uM |
| FMDB991 | NA | Antihypertensive Peptides Derived from soy Protein by Fermentation | LIVT | LIVT | 4 | Fermented soy protein (Defatted soya flour) | NA | NA | 37C | 36h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus caseispp. pseudoplantarum | NA | RPHPLC and sequence determination by Edman degradatiojn usng Applied Biosystems 477-A gas phase sequencer | NA | NA | 0.11uM | |
| FMDB992 | NA | rho09 | Purification and identification of an angiotensin I-converting enzyme inhibitory peptide from fermented soybean extract | LVQGS | LVQGS | 5 | fermented soy extract prepared from soy koji | NA | NA | 45C | 3days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | A.oryzae | NA | MALDI TOF MS and peptide sequencer | NA | 495.7Da | 43.7uM |
| FMDB993 | 12843654 | NA | NA | IFL | IFL | 3 | Tofuyo fermented soy food | alpha and beta subunit of beta conGlycinin | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | NA | NA | RPHPLC and automated degardation using gas/liquid phase protein sequencer | NA | NA | 44.8uM |
| FMDB994 | 12843654 | NA | NA | WL | WL | 2 | Tofuyo fermented soy food | B-B1A-&B subunits of Glycinin | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | NA | NA | RPHPLC and automated degardation using gas/liquid phase protein sequencer | NA | NA | 29.9uM |
| FMDB995 | NA | zhang06 | Angiotensin I-converting enzyme inhibitory peptides in douchi, a Chinese traditional fermented soybean product | FIG | FIG | 3 | Douchi fermented soy food of china | Glycinin | NA | 30C | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using Bz-Gly-His-Leu as substrate | Aspergillus Egyptiacus | NA | HPLC and amino acid analyser | NA | NA | NA |
| FMDB996 | 18627167 | NA | NA | DPVAPLQRSGPEI | DPVAPLQRSGPEI | 13 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | NA | 1149.6142 | 0.19 mg/mL |
| FMDB997 | 18627167 | NA | NA | PVAPQLSRGLL | PVAPQLSRGLL | 11 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS48 | NA | nanoLC-ESI-MS/MS | NA | 1149.687 | 0.19 mg/mL |
| FMDB998 | 18627167 | NA | NA | ELEIVMASPP | ELEIVMASPP | 10 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS49 | NA | nanoLC-ESI-MS/MS | NA | 1084.5474 | 0.19 mg/mL |
| FMDB999 | 18627167 | NA | NA | QILLPRPGQAA | QILLPRPGQAA | 11 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | NA | 1162.6822 | 0.19 mg/mL |
| FMDB1000 | 18627167 | NA | NA | PVAPLQRSGPE | PVAPLQRSGPE | 11 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | NA | 1149.6142 | 0.54 mg/mL |
| FMDB1001 | 18627167 | NA | NA | PRSGNVGESGL | PRSGNVGESGL | 11 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1149.687 | NA | 0.54 mg/mL |
| FMDB1002 | 18627167 | NA | NA | VAPSRPTPR | VAPSRPTPR | 9 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1084.5474 | NA | 0.54 mg/mL |
| FMDB1003 | 18627167 | NA | NA | DIIIPD | DIIIPD | 6 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1162.6822 | NA | 0.54 mg/mL |
| FMDB1004 | 18627167 | NA | NA | PRSGNVGESGLID | PRSGNVGESGLID | 13 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1299.6419 | NA | 0.45 mg/mL |
| FMDB1005 | 18627167 | NA | NA | DPVAPLQRSGPEI | DPVAPLQRSGPEI | 13 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1149.6142 | NA | 0.45 mg/mL |
| FMDB1006 | 18627167 | NA | NA | DPVAPLQRSGPEIP | DPVAPLQRSGPEIP | 14 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1262.6983 | NA | 0.45 mg/mL |
| FMDB1007 | 18627167 | NA | NA | PVAPLPRKGS | PVAPLPRKGS | 10 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1020.608 | NA | 0.45 mg/mL |
| FMDB1008 | 18627167 | NA | NA | DPVAPLQRSGPE | DPVAPLQRSGPE | 12 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 1020.5716 | NA | 0.45 mg/mL |
| FMDB1009 | 18627167 | NA | NA | SFTAGARTFNFDENPCDYFQGGKIKAT | SFTAGARTFNFDENPCDYFQGGKIKAT | 27 | wholemeal wheat flour sourdough | gliadin | 3.5-3.9 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus alimentarius 15M, Lactobacillus breVis 14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B Lb. sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47and Lc. lactis subsp. lactis PU1 | NA | nanoLC-ESI-MS/MS | 2984.3763 | NA | 0.45 mg/mL |
| FMDB1010 | NA | kuba09 | Angiotensin I-converting enzyme inhibitory peptides in red-mold rice made by Monascus purpureus | IY | IY | 2 | Red mold rice ( non glutinous rice) | NA | NA | 30C | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | M. purpureus IFO 4489 | proteinase | Automated Edman degradation with a gas/liquid phase protein sequencer | NA | NA | 4uM |
| FMDB1011 | NA | Angiotensin I-converting enzyme inhibitory peptides in red-mold rice made by Monascus purpureus | VVY | VVY | 3 | Red mold rice ( non glutinous rice) | NA | NA | 30C | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | M. purpureus IFO 4489 | proteinase | Automated Edman degradation with a gas/liquid phase protein sequencer | NA | NA | 22.0uM | |
| FMDB1012 | NA | Angiotensin I-converting enzyme inhibitory peptides in red-mold rice made by Monascus purpureus | VF | VF | 2 | Red mold rice ( non glutinous rice) | NA | NA | 30C | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | M. purpureus IFO 4489 | proteinase | Automated Edman degradation with a gas/liquid phase protein sequencer | NA | NA | 49.7uM | |
| FMDB1013 | NA | Angiotensin I-converting enzyme inhibitory peptides in red-mold rice made by Monascus purpureus | VW | VW | 2 | Red mold rice ( non glutinous rice) | NA | NA | 30C | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | M. purpureus IFO 4489 | proteinase | Automated Edman degradation with a gas/liquid phase protein sequencer | NA | NA | 3.1uM | |
| FMDB1016 | NA | nishibori13 | Angiotensin-I converting enzyme (ACE) inhibitory activity of aqueous extract prepared from fermented brown rice: A potential functional food for management of hypertension | small oilgopeptide | small oilgopeptide | 18 | Fermented rice brown extract | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | A.oryzae | NA | NA | NA | NA | NA |
| FMDB1023 | 22783093 | NA | NA | LAGNGRSVGVEYV | LAGNGRSVGVEYV | 13 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1024 | 22783093 | NA | NA | ATQVPLVSSTSEGYTASQPLYQP | ATQVPLVSSTSEGYTASQPLYQP | 23 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1025 | 22783093 | NA | NA | NPADLPDAG | NPADLPDAG | 9 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1026 | 22783093 | NA | NA | TRHNIGFAAVDALARAWNISLA | TRHNIGFAAVDALARAWNISLA | 22 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1027 | 22783093 | NA | NA | TTTAATS | TTTAATS | 7 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1028 | 22783093 | NA | NA | REGAAPGAA | REGAAPGAA | 9 | vitis hybrid red wine made from Vitis hybrid–Vitis coignetiae must | NA | NA | 25C | 10days | Ace-inhibitory;Antioxidant | In vitro | NA | Spectrophotometric assay using HHL as substrate;Antioxidant by DPPH | S. cerevisiae KCTC 7904 | NA | NA | NA | NA | NA |
| FMDB1029 | NA | lau13 | Novel angiotensin I-converting enzyme inhibitory peptides derived from an edible mushroom, Pleurotus cystidiosus O.K. Miller identified by LC-MS/MS | AHEPVK | AHEPVK | 6 | Edible Mushroom | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Ace inhibitory assay kit | Pleurotus cystidiosus | NA | LC-MS/MS | NA | 679.53 da | 62.8uM |
| FMDB1030 | NA | lau13 | Novel angiotensin I-converting enzyme inhibitory peptides derived from an edible mushroom, Pleurotus cystidiosus O.K. Miller identified by LC-MS/MS | GPSMR | GPSMR | 5 | Edible Mushroom | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Ace inhibitory assay kit | Pleurotus cystidiosus | NA | LC-MS/MS | NA | 546.36da | 277.5 uM |
| FMDB1047 | 17483275 | NA | NA | TEDELQDKIHP | TEDELQDKIHP | 11 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1323.61 | NA |
| FMDB1048 | 17483275 | NA | NA | EMPFPKYPVEP | EMPFPKYPVEP | 11 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1348.57 | NA |
| FMDB1049 | 17483275 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1219.55 | 83uM |
| FMDB1050 | 17483275 | NA | NA | ELEELNVPGE | ELEELNVPGE | 10 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1126.61 | NA |
| FMDB1051 | 17483275 | NA | NA | SQSKVLPVPQKAVPYPQ | SQSKVLPVPQKAVPYPQ | 17 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1082.25 | NA |
| FMDB1052 | 17483275 | NA | NA | EPVLGVRGPFP | EPVLGVRGPFP | 11 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1263.68 | 790uM |
| FMDB1053 | 17483275 | NA | NA | VPYPQRDMPIQA | VPYPQRDMPIQA | 12 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1413.59 | NA |
| FMDB1054 | 17483275 | NA | NA | NVPGEIVESL | NVPGEIVESL | 10 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1134.55 | NA |
| FMDB1055 | 17483275 | NA | NA | TTMLIQDEDDLEMA | TTMLIQDEDDLEMA | 14 | Bovine sodium Caseinate | Not matched | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1639.63 | NA |
| FMDB1056 | 17483275 | NA | NA | VPPFLQPEV | VPPFLQPEV | 9 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1024.57 | NA |
| FMDB1057 | 17483275 | NA | NA | EMPFPKYPVEP | EMPFPKYPVEP | 11 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1348.57 | NA |
| FMDB1058 | 17483275 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1082.25 | 92uM |
| FMDB1059 | 17483275 | NA | NA | EPVLGPVRGPFP | EPVLGPVRGPFP | 12 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1263.69 | NA |
| FMDB1060 | 17483275 | NA | NA | TQTPVVVPFFIQPE | TQTPVVVPFFIQPE | 14 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1550.71 | NA |
| FMDB1061 | 17483275 | NA | NA | NIPPLTQTPVVVPFFIQPEVMGVSK | NIPPLTQTPVVVPFFIQPEVMGVSK | 25 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 3128.65 | NA |
| FMDB1062 | 17483275 | NA | NA | NIPPLTQTPVVVPFFIQ | NIPPLTQTPVVVPFFIQ | 17 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 2183.97 | 450uM |
| FMDB1063 | 17483275 | NA | NA | VVPFFIQPE | VVPFFIQPE | 9 | Bovine sodium Caseinate | β-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1123.57 | NA |
| FMDB1064 | 17483275 | NA | NA | IASGEPTSTPTTE | IASGEPTSTPTTE | 13 | Bovine sodium Caseinate | k-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1289.55 | NA |
| FMDB1065 | 17483275 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Bovine sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1308.53 | 773.10uM |
| FMDB1066 | 17483275 | NA | NA | KHIQKEDVPSER | KHIQKEDVPSER | 12 | Bovine sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1464.67 | NA |
| FMDB1067 | 17483275 | NA | NA | IASGEPTSTPT | IASGEPTSTPT | 11 | Bovine sodium Caseinate | k-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1058.45 | NA |
| FMDB1068 | 17483275 | NA | NA | IQKEDVPSER | IQKEDVPSER | 10 | Bovine sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1199.53 | NA |
| FMDB1069 | 17483275 | NA | NA | IASGEPTSTPTTEA | IASGEPTSTPTTEA | 14 | Bovine sodium Caseinate | k-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1440.6 | NA |
| FMDB1070 | 17483275 | NA | NA | LSKDIGSESTEDQAMED | LSKDIGSESTEDQAMED | 17 | Bovine sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 2029.57 | NA |
| FMDB1071 | 17483275 | NA | NA | IVPNSVEQKH | IVPNSVEQKH | 10 | Bovine sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus animalis DPC6134 | NA | HCT-ion trap mass spectrometry | NA | 1228.61 | NA |
| FMDB1072 | NA | smacchi98 | Peptides from several Italian cheeses inhibitory to proteolytic enzymes of lactic acid bacteria, Pseudomonas fluorescens ATCC 948 and to the angiotensin I-converting enzyme | LVYPFPGPIHNSLPQ | LVYPFPGPIHNSLPQ | 15 | WSE of Crescenza cheese | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus delbrueckii ssp. bulgaricus B397, Streptococcus thermophilus 305, and Lactococcus lactis ssp. cremoris Wg2 | peptidases | NA | 835.0 (+2) | NA | NA |
| FMDB1129 | 23806758 | NA | NA | VGGASLKPEF | VGGASLKPEF | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 502.78+2 | NA | NA |
| FMDB1130 | 23806758 | NA | NA | VGLDTTKF | VGLDTTKF | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 440.75+2 | NA | NA |
| FMDB1131 | 23806758 | NA | NA | EVGGEALGRL | EVGGEALGRL | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 500.78+2 | NA | NA |
| FMDB1132 | 23806758 | NA | NA | QLGKAGIM | QLGKAGIM | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 417.27+2 | NA | NA |
| FMDB1133 | 23806758 | NA | NA | ASDPIL | ASDPIL | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 615.34+1 | NA | NA |
| FMDB1134 | 23806758 | NA | NA | ASDPILYRPVA | ASDPILYRPVA | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 601.34+2 | NA | NA |
| FMDB1135 | 23806758 | NA | NA | PILYRPVA | PILYRPVA | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 464.79+2 | NA | NA |
| FMDB1136 | 23806758 | NA | NA | SKHPGDFGAD | SKHPGDFGAD | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 515.73+2 | NA | NA |
| FMDB1137 | 23806758 | NA | NA | IVPIVE | IVPIVE | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 669.42+1 | NA | NA |
| FMDB1138 | 23806758 | NA | NA | AAVYKALSDHHIY | AAVYKALSDHHIY | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 496.6+3 | NA | NA |
| FMDB1139 | 23806758 | NA | NA | LSGGQSEEEASINL | LSGGQSEEEASINL | 14 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 717.37+2 | NA | NA |
| FMDB1140 | 23806758 | NA | NA | FISNHAY | FISNHAY | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 426.211+2 | NA | NA |
| FMDB1141 | 23806758 | NA | NA | SPLPVIPH | SPLPVIPH | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 430.26+2 | NA | NA |
| FMDB1142 | 23806758 | NA | NA | KLDVKGKRVVM | KLDVKGKRVVM | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 430.27+2 | NA | NA |
| FMDB1143 | 23806758 | NA | NA | MSHLGRPD | MSHLGRPD | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 464.72+2 | NA | NA |
| FMDB1144 | 23806758 | NA | NA | IKWGDAGATY | IKWGDAGATY | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 541.28+2 | NA | NA |
| FMDB1145 | 23806758 | NA | NA | GDAGATY | GDAGATY | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 654.28 | NA |
| FMDB1146 | 23806758 | NA | NA | VVESTGVF | VVESTGVF | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 837.44 | NA |
| FMDB1147 | 23806758 | NA | NA | GYSNRVVDL | GYSNRVVDL | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 511.77+2 | NA | NA |
| FMDB1148 | 23806758 | NA | NA | AMQKIF | AMQKIF | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 377.2+2 | NA | NA |
| FMDB1149 | 23806758 | NA | NA | DSRGNPTVEVD | DSRGNPTVEVD | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 594.79+2 | NA | NA |
| FMDB1150 | 23806758 | NA | NA | KVVIGM | KVVIGM | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 331.7+2 | NA | NA |
| FMDB1151 | 23806758 | NA | NA | VVIGM | VVIGM | 5 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 534.3 | NA |
| FMDB1152 | 23806758 | NA | NA | IKNYPVVSIED | IKNYPVVSIED | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 638.85+2 | NA | NA |
| FMDB1153 | 23806758 | NA | NA | NTNHGRILL | NTNHGRILL | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 519.3+2 | NA | NA |
| FMDB1154 | 23806758 | NA | NA | GTHIAKTL | GTHIAKTL | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 420.75+2 | NA | NA |
| FMDB1155 | 23806758 | NA | NA | PSAVAKHFVA | PSAVAKHFVA | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 513.79+2 | NA | NA |
| FMDB1156 | 23806758 | NA | NA | VIQTGVD | VIQTGVD | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 731.4 | NA |
| FMDB1157 | 23806758 | NA | NA | VGSVF | VGSVF | 5 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 508.28 | NA |
| FMDB1158 | 23806758 | NA | NA | GGKDQRLP | GGKDQRLP | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 435.77+2 | NA | NA |
| FMDB1159 | 23806758 | NA | NA | LVGGASLKPEF | LVGGASLKPEF | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 559.33 | NA |
| FMDB1160 | 23806758 | NA | NA | KSLLGK | KSLLGK | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 323.22+2 | NA | NA |
| FMDB1161 | 23806758 | NA | NA | KSLLGKD | KSLLGKD | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 380.74+2 | NA | NA |
| FMDB1162 | 23806758 | NA | NA | KSLLGKDVL | KSLLGKDVL | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 486.82+2 | NA | NA |
| FMDB1163 | 23806758 | NA | NA | LEGKVLPGVDALS | LEGKVLPGVDALS | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 649.39+2 | NA | NA |
| FMDB1164 | 23806758 | NA | NA | PFGNTHNKYKLNF | PFGNTHNKYKLNF | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 527.28+3 | NA | NA |
| FMDB1165 | 23806758 | NA | NA | PGHPFIM | PGHPFIM | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 407.71+2 | NA | NA |
| FMDB1166 | 23806758 | NA | NA | IDDHFL | IDDHFL | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 380.2+2 | NA | NA |
| FMDB1167 | 23806758 | NA | NA | KPVSPLL | KPVSPLL | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 377.25+2 | NA | NA |
| FMDB1168 | 23806758 | NA | NA | TAAVGSVF | TAAVGSVF | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 751.42 | NA |
| FMDB1169 | 23806758 | NA | NA | YVTAIRNL | YVTAIRNL | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 475.292+ | NA |
| FMDB1170 | 23806758 | NA | NA | VILFH | VILFH | 5 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 314.7+2 | NA | NA |
| FMDB1171 | 23806758 | NA | NA | AAVYKALSDHHIYL | AAVYKALSDHHIYL | 14 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 534.3+3 | NA | NA |
| FMDB1172 | 23806758 | NA | NA | YKALSDHHIYL | YKALSDHHIYL | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 453.92+3 | NA | NA |
| FMDB1173 | 23806758 | NA | NA | VDTSKGFLID | VDTSKGFLID | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 547.8+2 | NA | NA |
| FMDB1174 | 23806758 | NA | NA | PILYRPVAVA | PILYRPVAVA | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 549.85+2 | NA | NA |
| FMDB1175 | 23806758 | NA | NA | QQAVRAIVSCFPN | QQAVRAIVSCFPN | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 478.26+3 | NA | NA |
| FMDB1176 | 23806758 | NA | NA | QLVMFVLQL | QLVMFVLQL | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 545.83+2 | NA | NA |
| FMDB1177 | 23806758 | NA | NA | FISNHAY | FISNHAY | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 426.211+2 | NA | NA |
| FMDB1178 | 23806758 | NA | NA | AMQKIF oxidation (M) b | AMQKIF | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 377.2+2 | NA | NA |
| FMDB1179 | 23806758 | NA | NA | LKTAIQAAGYPDKVoxidation (M);deamidated (NQ)c | LKTAIQAAGYPDKV | 14 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 631.36+2 | NA | NA |
| FMDB1180 | 23806758 | NA | NA | IKNYPVVSIED | IKNYPVVSIED | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 638.85+2 | NA | NA |
| FMDB1181 | 23806758 | NA | NA | AAVYKALSDHHIY | AAVYKALSDHHIY | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 496.59+2 | NA | NA |
| FMDB1182 | 23806758 | NA | NA | SDHHIYL | SDHHIYL | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 442.72+2 | NA | NA |
| FMDB1183 | 23806758 | NA | NA | LSGGQSEEEASINL | LSGGQSEEEASINL | 14 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 717.35+2 | NA | NA |
| FMDB1184 | 23806758 | NA | NA | TFSYGRALQA | TFSYGRALQA | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 557.3+2 | NA | NA |
| FMDB1185 | 23806758 | NA | NA | FISNHAY | FISNHAY | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 426.211+2 | NA | NA |
| FMDB1186 | 23806758 | NA | NA | MVLPPP | MVLPPP | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 669.43+1 | NA | NA |
| FMDB1187 | 23806758 | NA | NA | VGLDTTKF | VGLDTTKF | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 440.74+2 | NA | NA |
| FMDB1188 | 23806758 | NA | NA | VGGASLKPEF | VGGASLKPEF | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 502.78+ 2 | NA | NA |
| FMDB1189 | 23806758 | NA | NA | SPLPVIPH | SPLPVIPH | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 430.26+2 | NA | NA |
| FMDB1190 | 23806758 | NA | NA | MPQQIGVP | MPQQIGVP | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 435.77+2 | NA | NA |
| FMDB1191 | 23806758 | NA | NA | KETPSGFTLD | KETPSGFTLD | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 547.78+2 | NA | NA |
| FMDB1192 | 23806758 | NA | NA | VIQTGVD | VIQTGVD | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 731.4 +1 | NA | NA |
| FMDB1193 | 23806758 | NA | NA | YYKATEPVI | YYKATEPVI | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 542.29+2 | NA | NA |
| FMDB1194 | 23806758 | NA | NA | PAKIEAF | PAKIEAF | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 388.23+ 2 | NA | NA |
| FMDB1195 | 25218972 | NA | NA | LAFNPTQLEGQCHV | LAFNPTQLEGQCHV | 14 | Sheep cheese Whey | ovine βlactoglobulin, f(149–162) | NA | 45c | 4h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Bacillus sp.P7 | protease | nano-ESI-MS | 778.8811 | NA | NA |
| FMDB1196 | 25218972 | NA | NA | LAFNPTQLEGQCHV | LAFNPTQLEGQCHV | 14 | Sheep cheese Whey | ovine βlactoglobulin, f(149–162) | NA | 45c | 4h | Antioxidant | In vitro | NA | ABTS radical scavenging assay | Bacillus sp.P7 | protease | nano-ESI-MS | 778.8811 | NA | NA |
| FMDB1203 | 10908049 | NA | NA | FVAPFPQV | FVAPFPQV | 8 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 905.6 | NA |
| FMDB1206 | 10966406 | NA | NA | QSKVLPVPE | QSKVLPVPE | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 997.7 | NA |
| FMDB1207 | 10966406 | NA | NA | SLSQSKVLPVPE | SLSQSKVLPVPE | 12 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1283 | NA |
| FMDB1208 | 10966406 | NA | NA | KVKPVPEKAVPYPQ | KVKPVPEKAVPYPQ | 14 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1564 0.7 | NA |
| FMDB1212 | 10966406 | NA | NA | GVSKVEAMAPKHKEM PFPKYPVQPF | GVSKVEAMAPKHKEM PFPKYPVQPF | 26 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 2973.3 | NA |
| FMDB1214 | 10966406 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1152 | NA |
| FMDB1215 | 10966406 | NA | NA | TQTPVVVPPFLQPEVM | TQTPVVVPPFLQPEVM | 16 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1782.7 | NA |
| FMDB1224 | 10908049 | NA | NA | FVAPFPQV | FVAPFPQV | 8 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 905.6 | NA |
| FMDB1227 | 10966406 | NA | NA | QSKVLPVPE | QSKVLPVPE | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 997.7 | NA |
| FMDB1228 | 10966406 | NA | NA | SLSQSKVLPVPE | SLSQSKVLPVPE | 12 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1283 | NA |
| FMDB1229 | 10966406 | NA | NA | KVKPVPEKAVPYPQ | KVKPVPEKAVPYPQ | 14 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1564 0.7 | NA |
| FMDB1233 | 10966406 | NA | NA | GVSKVEAMAPKHKEM PFPKYPVQPF | GVSKVEAMAPKHKEM PFPKYPVQPF | 26 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 2973.3 | NA |
| FMDB1235 | 10966406 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1152 | NA |
| FMDB1236 | 10966406 | NA | NA | TQTPVVVPPFLQPEVM | TQTPVVVPPFLQPEVM | 16 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1782.7 | NA |
| FMDB1239 | 10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 1140.9 | NA |
| FMDB1240 | 10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1140.9 | NA |
| FMDB1241 | 10908049 | NA | NA | FPGP | FPGP | 4 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 417.3 | NA |
| FMDB1242 | 10908049 | NA | NA | FPGP | FPGP | 4 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 417.3 | NA |
| FMDB1244 | 10908049 | NA | NA | KAVPYPQE | KAVPYPQE | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 802.6 | NA |
| FMDB1245 | 10908049 | NA | NA | KAVPYPQE | KAVPYPQE | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 802.6 | NA |
| FMDB1247 | 10908049 | NA | NA | TESQSLTLT | TESQSLTLT | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 979.7 | NA |
| FMDB1248 | 10966406 | NA | NA | NVPGEIVE | NVPGEIVE | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 856.4 | NA |
| FMDB1249 | 10966406 | NA | NA | NVPGEIVE | NVPGEIVE | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 856.4 | NA |
| FMDB1250 | 10966406 | NA | NA | SWM | SWM | 3 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 423.1 | NA |
| FMDB1251 | 10966406 | NA | NA | SWM | SWM | 3 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 423.1 | NA |
| FMDB1252 | 10966406 | NA | NA | KVLPVPE | KVLPVPE | 7 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 780.6 | NA |
| FMDB1253 | 10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 756.4 | NA |
| FMDB1254 | 10966406 | NA | NA | SLSQKVLPVPE | SLSQKVLPVPE | 11 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1282.8 | NA |
| FMDB1255 | 10966406 | NA | NA | SLSQKVLPVPE | SLSQKVLPVPE | 11 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 1282.8 | NA |
| FMDB1256 | 10966406 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 977.7 | NA |
| FMDB1257 | 10966406 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 977.7 | NA |
| FMDB1268 | 10966406 | NA | NA | HKEMPFPKYPVQPF | HKEMPFPKYPVQPF | 14 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 1746.1 | NA |
| FMDB1269 | 10966406 | NA | NA | HKEMPFPKYPVQPF | HKEMPFPKYPVQPF | 14 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1746.1 | NA |
| FMDB1272 | 10966406 | NA | NA | QQPVLGPVRGPFPIIV | QQPVLGPVRGPFPIIV | 16 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 1718.6 | NA |
| FMDB1273 | 10966406 | NA | NA | QQPVLGPVRGPFPIIV | QQPVLGPVRGPFPIIV | 16 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1718.6 | NA |
| FMDB1274 | 10966406 | NA | NA | YQQPVLGPVRGPFPIIV | YQQPVLGPVRGPFPIIV | 17 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1881.3 | NA |
| FMDB1275 | 10966406 | NA | NA | SLPQNIPPLTQTPVV.QPEVM | SLPQNIPPLTQTPVV.QPEVM | 21 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 2742.9 | NA |
| FMDB1276 | 10966406 | NA | NA | SLPQNIPPLTQTPVV.QPEVM | SLPQNIPPLTQTPVV.QPEVM | 21 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 2742.9 | NA |
| FMDB1280 | 10966406 | NA | NA | SLPQNIPPLTQTPVV.AMAPK | SLPQNIPPLTQTPVV.AMAPK | 21 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 3969.1 | NA |
| FMDB1286 | 20172208 | NA | NA | YQDPRLGPTGELDPATQPIVAVHNPVIV | YQDPRLGPTGELDPATQPIVAVHNPVIV | 28 | Koumiss ( fermented mare's Milk) | β-Casein | NA | NA | NA | Anti-hypertensive | In vitro | NA | NA | LAB and yeast | NA | NA | NA | NA | 14.53 ± 0.21 μM |
| FMDB1287 | 20172208 | NA | NA | PKDLREN | PKDLREN | 7 | Koumiss ( fermented mare's Milk) | Not known | NA | NA | NA | Anti-hypertensive | In vitro | NA | NA | LAB and yeast | NA | NA | NA | NA | 9.82 ± 0.37 μM |
| FMDB1288 | 20172208 | NA | NA | LLLAHLL | LLLAHLL | 7 | Koumiss ( fermented mare's Milk) | Not known | NA | NA | NA | Anti-hypertensive | In vitro | NA | NA | LAB and yeast | NA | NA | NA | NA | 5.19 ± 0.18 μM |
| FMDB1289 | 20172208 | NA | NA | NHRNRMMDHVH | NHRNRMMDHVH | 11 | Koumiss ( fermented mare's Milk) | Not known | NA | NA | NA | Anti-hypertensive | In vitro | NA | NA | LAB and yeast | NA | NA | NA | NA | 13.42 ± 0.17 μM |
| FMDB1290 | NA | li15 | Purification and identification of novel peptides with inhibitory effect against angiotensin I-converting enzyme and optimization of process conditions in Milk fermented with the yeast Kluyveromyces marxianus | VLSRYP | VLSRYP | 6 | Fermented Milk (reconstituted skim Milk) | k-Casein | 4.3 | 32c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay By HPLC | Kluyveromyces marxianus Z17 | proteinase and peptidase | MALDI/TOF-TOF MS/MS | NA | NA | 36.7 uM |
| FMDB1291 | NA | li15 | NA | LRFF | LRFF | 4 | Fermented Milk (reconstituted skim Milk) | αS1-Casein | 4.3 | 32c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay By HPLC | Kluyveromyces marxianus Z17 | proteinase and peptidase | MALDI/TOF-TOF MS/MS | NA | NA | 116.9uM |
| FMDB1292 | NA | farvin10 | Antioxidant activity of Yogurt peptides: Part 2 – Characterisation of peptide fractions | QQQTED | QQQTED | 6 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 748 | NA |
| FMDB1293 | NA | farvin10 | NA | NSKKTVD | NSKKTVD | 7 | fish oil enriched Yogurt | αS2-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 791.4 | NA |
| FMDB1294 | NA | farvin10 | NA | YP | YP | 2 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 279 | NA |
| FMDB1295 | NA | farvin10 | NA | YAKPA | YAKPA | 5 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 549.2 | NA |
| FMDB1296 | NA | farvin10 | NA | TVQVT | TVQVT | 5 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 547.2 | NA |
| FMDB1297 | NA | farvin10 | NA | TVQVTST | TVQVTST | 7 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 735.4 | NA |
| FMDB1298 | NA | farvin10 | NA | VPYPQ | VPYPQ | 5 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 603.3 | NA |
| FMDB1299 | NA | farvin10 | NA | PIGSENS | PIGSENS | 7 | fish oil enriched Yogurt | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 703.4 | NA |
| FMDB1300 | NA | farvin10 | NA | KAVPYPQ | KAVPYPQ | 7 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 802.5 | NA |
| FMDB1301 | NA | farvin10 | NA | TVQVTSTAV | TVQVTSTAV | 9 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 905.5 | NA |
| FMDB1302 | NA | farvin10 | NA | IESPPEIN | IESPPEIN | 8 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 898.3 | NA |
| FMDB1303 | NA | farvin10 | NA | NVPGEIVE | NVPGEIVE | 8 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 856.4 | NA |
| FMDB1304 | NA | farvin10 | NA | VIESPPEIN | VIESPPEIN | 9 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 997.6 | NA |
| FMDB1305 | NA | farvin10 | NA | KVLPVPE | KVLPVPE | 7 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 780.6 | NA |
| FMDB1306 | NA | farvin10 | NA | GVRGPFPII | GVRGPFPII | 9 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 996.3 | NA |
| FMDB1307 | NA | farvin10 | NA | DKIHPF | DKIHPF | 6 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 756.3 | NA |
| FMDB1308 | NA | farvin10 | NA | IPIQY | IPIQY | 5 | fish oil enriched Yogurt | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 633.3 | NA |
| FMDB1309 | NA | farvin10 | NA | VFGKEKVNEL | VFGKEKVNEL | 10 | fish oil enriched Yogurt | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1162.7 | NA |
| FMDB1310 | NA | farvin10 | NA | ELQDKIHPF | ELQDKIHPF | 9 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1126.6 | NA |
| FMDB1311 | NA | farvin10 | NA | YPFPGPIPN | YPFPGPIPN | 9 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1001.6 | NA |
| FMDB1312 | NA | farvin10 | NA | QQPVLGPVRGPFP | QQPVLGPVRGPFP | 13 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1392.9 | NA |
| FMDB1313 | NA | farvin10 | NA | HKEMPFPKYPVQPF | HKEMPFPKYPVQPF | 14 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1746.9 | NA |
| FMDB1314 | NA | farvin10 | NA | MAPKHKEMPFPKYPVQPF | MAPKHKEMPFPKYPVQPF | 18 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 2173.2 | NA |
| FMDB1315 | NA | farvin10 | NA | LVYPFPGPIPN | LVYPFPGPIPN | 11 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1213.6 | NA |
| FMDB1316 | NA | farvin10 | NA | SLVYPFPGPIPN | SLVYPFPGPIPN | 12 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1300.6 | NA |
| FMDB1317 | NA | farvin10 | NA | MPFPKYPVQPF | MPFPKYPVQPF | 11 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1351.6 | NA |
| FMDB1318 | NA | farvin10 | NA | TQTPVVVPPFLQPE | TQTPVVVPPFLQPE | 14 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1552.4 | NA |
| FMDB1319 | NA | farvin10 | NA | YQQPVLGPVRGPFPII | YQQPVLGPVRGPFPII | 16 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1782.1 | NA |
| FMDB1320 | NA | farvin10 | NA | RDMPIQAFLL | RDMPIQAFLL | 10 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1203.7 | NA |
| FMDB1321 | NA | farvin10 | NA | QQPVLGPVRGPFPIIV | QQPVLGPVRGPFPIIV | 16 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1719 | NA |
| FMDB1322 | NA | farvin10 | NA | YQQPVLGPVRGPFPIIV | YQQPVLGPVRGPFPIIV | 17 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1882.1 | NA |
| FMDB1323 | NA | farvin10 | NA | MAPKHEMPFPKYP | MAPKHEMPFPKYP | 13 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 1701.5 | NA |
| FMDB1324 | NA | farvin10 | NA | SLPQNIPPLTQTPVVVPFLQPEVM | SLPQNIPPLTQTPVVVPFLQPEVM | 24 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 2742.2 | NA |
| FMDB1325 | NA | farvin10 | NA | NIPPLTQTPVVVPFLQPEVM | NIPPLTQTPVVVPFLQPEVM | 20 | fish oil enriched Yogurt | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | Assay by DPPH radicalscavenging | NA | NA | LC-MS/MS | NA | 2317.2 | NA |
| FMDB1326 | 23845432 | NA | Enterococcus faecalis strains from food, environmental, and clinical origin produce ACE-inhibitory peptides and other bioactive peptides during growth in bovine skim Milk | VLGP | VLGP | 4 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 384.2 | 34.2ug protein/ml |
| FMDB1327 | 23845432 | NA | NA | VLGP | VLGP | 4 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 384.2 | 25.9ug protein/ml |
| FMDB1328 | 23845432 | NA | NA | VLGP | VLGP | 4 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10. | NA | RP-HPLC–MS/MS | NA | 384.2 | 27.9ug protein/ml |
| FMDB1329 | 23845432 | NA | NA | PGPIHN | PGPIHN | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 633.4 | 24.3ug protein/ml |
| FMDB1330 | 23845432 | NA | NA | PGPIHN | PGPIHN | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 633.4 | 25.9ug protein/ml |
| FMDB1331 | 23845432 | NA | NA | LLQSW | LLQSW | 5 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 645.4 | 34.2ug protein/ml |
| FMDB1332 | 23845432 | NA | NA | IPPLTQ | IPPLTQ | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4; | NA | RP-HPLC–MS/MS | NA | 668.2 | 25.9ug protein/ml |
| FMDB1333 | 23845432 | NA | NA | IPPLTQ | IPPLTQ | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis 3Er1 | NA | RP-HPLC–MS/MS | NA | 668.2 | 38.4ug protein/ml |
| FMDB1334 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 671.3 | 24.3ug protein/ml |
| FMDB1335 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 671.3 | 34.2ug protein/ml |
| FMDB1336 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 671.3 | 25.9ug protein/ml |
| FMDB1337 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 671.3 | 27.9ug protein/ml |
| FMDB1338 | 23845432 | NA | NA | RELEE | RELEE | 5 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 674.3 | 24.3ug protein/ml |
| FMDB1339 | 23845432 | NA | NA | RELEE | RELEE | 5 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 674.3 | 34.2ug protein/ml |
| FMDB1340 | 23845432 | NA | NA | RELEE | RELEE | 5 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 674.3 | 34.2ug protein/ml |
| FMDB1341 | 23845432 | NA | NA | FAQTQS | FAQTQS | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 680.3 | 25.9ug protein/ml |
| FMDB1342 | 23845432 | NA | NA | FAQTQS | FAQTQS | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 680.3 | 25.9ug protein/ml |
| FMDB1343 | 23845432 | NA | NA | FAQTQS | FAQTQS | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis 3Er1 | NA | RP-HPLC–MS/MS | NA | 680.3 | 38.4ug protein/ml |
| FMDB1344 | 23845432 | NA | NA | FAQTQS | FAQTQS | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 680.3 | 27.9ug protein/ml |
| FMDB1345 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 688.4 | 24.3ug protein/ml |
| FMDB1346 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 688.4 | 34.2ug protein/ml |
| FMDB1347 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 688.4 | 25.9ug protein/ml |
| FMDB1348 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis 3Er1 | NA | RP-HPLC–MS/MS | NA | 688.4 | 38.4ug protein/ml |
| FMDB1349 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 688.4 | 27.9ug protein/ml |
| FMDB1350 | 23845432 | NA | NA | FTESQS | FTESQS | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 697.2 | 24.3ug protein/ml |
| FMDB1351 | 23845432 | NA | NA | FTESQS | FTESQS | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 697.2 | 34.2ug protein/ml |
| FMDB1352 | 23845432 | NA | NA | FTESQS | FTESQS | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 697.2 | 25.9ug protein/ml |
| FMDB1353 | 23845432 | NA | NA | FTESQS | FTESQS | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 697.2 | 27.9ug protein/ml |
| FMDB1354 | 23845432 | NA | NA | PQRDMP | PQRDMP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 742.3 | 24.3ug protein/ml |
| FMDB1355 | 23845432 | NA | NA | PQRDMP | PQRDMP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 742.3 | 34.2ug protein/ml |
| FMDB1356 | 23845432 | NA | NA | PQRDMP | PQRDMP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 742.3 | 25.9ug protein/ml |
| FMDB1357 | 23845432 | NA | NA | LLYQEP | LLYQEP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 761.3 | 34.2ug protein/ml |
| FMDB1358 | 23845432 | NA | NA | LLYQEP | LLYQEP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 761.3 | 25.9ug protein/ml |
| FMDB1359 | 23845432 | NA | NA | LLYQEP | LLYQEP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 761.3 | 27.9ug protein/ml |
| FMDB1360 | 23845432 | NA | NA | LQPEVMG | LQPEVMG | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 772.4 | 24.3ug protein/ml |
| FMDB1361 | 23845432 | NA | NA | LQPEVMG | LQPEVMG | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 772.4 | 25.9ug protein/ml |
| FMDB1362 | 23845432 | NA | NA | VLPVPQK | VLPVPQK | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 779.4 | 24.3ug protein/ml |
| FMDB1363 | 23845432 | NA | NA | VLPVPQK | VLPVPQK | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 779.4 | 34.2ug protein/ml |
| FMDB1364 | 23845432 | NA | NA | VLPVPQK | VLPVPQK | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 779.4 | 25.9ug protein/ml |
| FMDB1365 | 23845432 | NA | NA | VLPVPQK | VLPVPQK | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 779.4 | 27.9ug protein/ml |
| FMDB1366 | 23845432 | NA | NA | LHLPLPL | LHLPLPL | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 801.6 | 24.3ug protein/ml |
| FMDB1367 | 23845432 | NA | NA | LHLPLPL | LHLPLPL | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 801.6 | 34.2ug protein/ml |
| FMDB1368 | 23845432 | NA | NA | ITRINKK | ITRINKK | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 871.4 | 34.2ug protein/ml |
| FMDB1369 | 23845432 | NA | NA | LTLTDVEN | LTLTDVEN | 8 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 903.3 | 24.3ug protein/ml |
| FMDB1370 | 23845432 | NA | NA | LTLTDVEN | LTLTDVEN | 8 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 903.3 | 27.9ug protein/ml |
| FMDB1371 | 23845432 | NA | NA | LHLPLPLL | LHLPLPLL | 8 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 915.4 | 25.9ug protein/ml |
| FMDB1372 | 23845432 | NA | NA | LHLPLPLL | LHLPLPLL | 8 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis 3Er1 | NA | RP-HPLC–MS/MS | NA | 915.4 | 38.4ug protein/ml |
| FMDB1373 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 996.5 | 24.3ug protein/ml |
| FMDB1374 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 996.5 | 34.2ug protein/ml |
| FMDB1375 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 996.5 | 25.9ug protein/ml |
| FMDB1376 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 996.5 | 27.9ug protein/ml |
| FMDB1377 | 23845432 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 1037.4 | 34.2ug protein/ml |
| FMDB1378 | 23845432 | NA | NA | LTQTPVVVPPF | LTQTPVVVPPF | 11 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 1196.4 | 24.3ug protein/ml |
| FMDB1379 | 23845432 | NA | NA | LTQTPVVVPPF | LTQTPVVVPPF | 11 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 1196.4 | 34.2ug protein/ml |
| FMDB1380 | 23845432 | NA | NA | LTQTPVVVPPF | LTQTPVVVPPF | 11 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 1196.4 | 25.9ug protein/ml |
| FMDB1381 | 23845432 | NA | NA | LLRF | LLRF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA21 | NA | RP-HPLC–MS/MS | NA | 547.4 | 19.5ug protein/ml |
| FMDB1382 | 23845432 | NA | NA | LLRF | LLRF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA12 | NA | RP-HPLC–MS/MS | NA | 547.4 | 22.8ug protein/ml |
| FMDB1383 | 23845432 | NA | NA | LLRF | LLRF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 547.4 | 28.4ug protein/ml |
| FMDB1384 | 23845432 | NA | NA | LGTQY | LGTQY | 5 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 580.3 | 27.9ug protein/ml |
| FMDB1385 | 23845432 | NA | NA | FRQF | FRQF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 596.3 | 24.3ug protein/ml |
| FMDB1386 | 23845432 | NA | NA | RPKHP | RPKHP | 5 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 633.4 | 24.3ug protein/ml |
| FMDB1387 | 23845432 | NA | NA | FVAPFP | FVAPFP | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 676.4 | 24.3ug protein/ml |
| FMDB1388 | 23845432 | NA | NA | FVAPFP | FVAPFP | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 676.4 | 34.2ug protein/ml |
| FMDB1389 | 23845432 | NA | NA | FVAPFP | FVAPFP | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 676.4 | 25.9ug protein/ml |
| FMDB1390 | 23845432 | NA | NA | FVAPFP | FVAPFP | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis 3Er1 | NA | RP-HPLC–MS/MS | NA | 676.4 | 38.4ug protein/ml |
| FMDB1391 | 23845432 | NA | NA | FVAPFP | FVAPFP | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 676.4 | 27.9ug protein/ml |
| FMDB1392 | 23845432 | NA | NA | LEIVPK | LEIVPK | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 683.4 | 25.9ug protein/ml |
| FMDB1393 | 23845432 | NA | NA | LEIVPK | LEIVPK | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis 3Er1 | NA | RP-HPLC–MS/MS | NA | 683.4 | 38.4ug protein/ml |
| FMDB1394 | 23845432 | NA | NA | LEIVPK | LEIVPK | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 683.4 | 27.9ug protein/ml |
| FMDB1395 | 23845432 | NA | NA | VLNENL | VLNENL | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 700.4 | 34.2ug protein/ml |
| FMDB1396 | 23845432 | NA | NA | VLNENL | VLNENL | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis P4 | NA | RP-HPLC–MS/MS | NA | 700.4 | 25.9ug protein/ml |
| FMDB1397 | 23845432 | NA | NA | VLNENL | VLNENL | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis 3Er1 | NA | RP-HPLC–MS/MS | NA | 700.4 | 38.4ug protein/ml |
| FMDB1398 | 23845432 | NA | NA | VLNENL | VLNENL | 6 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis H10 | NA | RP-HPLC–MS/MS | NA | 700.4 | 27.9ug protein/ml |
| FMDB1399 | 23845432 | NA | NA | LHSMKEG | LHSMKEG | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 800.3 | 34.2ug protein/ml |
| FMDB1400 | 23845432 | NA | NA | FPEVFGK | FPEVFGK | 7 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 822.4 | 24.3ug protein/ml |
| FMDB1401 | 23845432 | NA | NA | IPNPIGSE | IPNPIGSE | 8 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 825.6 | 24.3ug protein/ml |
| FMDB1405 | 23845432 | NA | NA | VVVPPF | VVVPPF | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 656.2 | 28.4ug protein/ml |
| FMDB1406 | 23845432 | NA | NA | VVVPPF | VVVPPF | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis CGV67 | NA | RP-HPLC–MS/MS | NA | 656.2 | 24.9ug protein/ml |
| FMDB1407 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 671.3 | 28.4ug protein/ml |
| FMDB1408 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis CECT184 | NA | RP-HPLC–MS/MS | NA | 671.3 | 16.1ug protein/ml |
| FMDB1409 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis CGV67 | NA | RP-HPLC–MS/MS | NA | 671.3 | 24.9ug protein/ml |
| FMDB1410 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 671.3 | 23.8ug protein/ml |
| FMDB1411 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis LG101 | NA | RP-HPLC–MS/MS | NA | 671.3 | 16.1ug protein/ml |
| FMDB1412 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA12 | NA | RP-HPLC–MS/MS | NA | 671.3 | 22.8ug protein/ml |
| FMDB1413 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA21 | NA | RP-HPLC–MS/MS | NA | 671.3 | 19.5ug protein/ml |
| FMDB1414 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 671.3 | 24.8ug protein/ml |
| FMDB1415 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA127 | NA | RP-HPLC–MS/MS | NA | 671.3 | 20.8ug protein/ml |
| FMDB1416 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QF386 | NA | RP-HPLC–MS/MS | NA | 671.3 | 21.4ug protein/ml |
| FMDB1417 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QM38 | NA | RP-HPLC–MS/MS | NA | 671.3 | 17.8ug protein/ml |
| FMDB1418 | 23845432 | NA | NA | VRGPFP | VRGPFP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis SMF54. | NA | RP-HPLC–MS/MS | NA | 671.3 | 27.3ug protein/ml |
| FMDB1449 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 688.4 | 28.4ug protein/ml |
| FMDB1450 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis BCS53 | NA | RP-HPLC–MS/MS | NA | 688.4 | 26.3ug protein/ml |
| FMDB1451 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis CECT184 | NA | RP-HPLC–MS/MS | NA | 688.4 | 16.1ug protein/ml |
| FMDB1452 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis CGV67 | NA | RP-HPLC–MS/MS | NA | 688.4 | 24.9ug protein/ml |
| FMDB1453 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 688.4 | 23.8ug protein/ml |
| FMDB1454 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis LG101 | NA | RP-HPLC–MS/MS | NA | 688.4 | 16.1ug protein/ml |
| FMDB1455 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA12 | NA | RP-HPLC–MS/MS | NA | 688.4 | 22.8ug protein/ml |
| FMDB1456 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA21 | NA | RP-HPLC–MS/MS | NA | 688.4 | 19.5ug protein/ml |
| FMDB1457 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 688.4 | 24.8ug protein/ml |
| FMDB1458 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA127 | NA | RP-HPLC–MS/MS | NA | 688.4 | 20.8ug protein/ml |
| FMDB1459 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QF386 | NA | RP-HPLC–MS/MS | NA | 688.4 | 21.4ug protein/ml |
| FMDB1460 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QM38 | NA | RP-HPLC–MS/MS | NA | 688.4 | 17.8ug protein/ml |
| FMDB1461 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis SDM37 | NA | RP-HPLC–MS/MS | NA | 688.4 | 25.1ug protein/ml |
| FMDB1462 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis SDP10 | NA | RP-HPLC–MS/MS | NA | 688.4 | 26.3ug protein/ml |
| FMDB1463 | 23845432 | NA | NA | LHLPLP | LHLPLP | 6 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis SMF54. | NA | RP-HPLC–MS/MS | NA | 688.4 | 27.3ug protein/ml |
| FMDB1482 | 23845432 | NA | NA | VSKVKET | VSKVKET | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis SDM37 | NA | RP-HPLC–MS/MS | NA | 759.3 | 25.1ug protein/ml |
| FMDB1502 | 23845432 | NA | NA | LHLPLPL | LHLPLPL | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 801.6 | 28.4ug protein/ml |
| FMDB1503 | 23845432 | NA | NA | LHLPLPL | LHLPLPL | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis CGV67 | NA | RP-HPLC–MS/MS | NA | 801.6 | 24.9ug protein/ml |
| FMDB1504 | 23845432 | NA | NA | LHLPLPL | LHLPLPL | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis SDM37 | NA | RP-HPLC–MS/MS | NA | 801.6 | 25.1ug protein/ml |
| FMDB1505 | 23845432 | NA | NA | LHLPLPL | LHLPLPL | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis SDP10 | NA | RP-HPLC–MS/MS | NA | 801.6 | 26.3ug protein/ml |
| FMDB1506 | 23845432 | NA | NA | LHLPLPL | LHLPLPL | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis SMF54. | NA | RP-HPLC–MS/MS | NA | 801.6 | 27.3ug protein/ml |
| FMDB1514 | 23845432 | NA | NA | LQDKIHP | LQDKIHP | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis CECT184 | NA | RP-HPLC–MS/MS | NA | 849.3 | 16.1ug protein/ml |
| FMDB1515 | 23845432 | NA | NA | LQDKIHP | LQDKIHP | 7 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis SDM37 | NA | RP-HPLC–MS/MS | NA | 849.3 | 25.1ug protein/ml |
| FMDB1524 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 996.5 | 28.4ug protein/ml |
| FMDB1525 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis BCS53 | NA | RP-HPLC–MS/MS | NA | 996.5 | 26.3ug protein/ml |
| FMDB1526 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis CECT184 | NA | RP-HPLC–MS/MS | NA | 996.5 | 16.1ug protein/ml |
| FMDB1527 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis CGV67 | NA | RP-HPLC–MS/MS | NA | 996.5 | 24.9ug protein/ml |
| FMDB1528 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis DBH18 | NA | RP-HPLC–MS/MS | NA | 996.5 | 23.8ug protein/ml |
| FMDB1529 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis LG101 | NA | RP-HPLC–MS/MS | NA | 996.5 | 16.1ug protein/ml |
| FMDB1530 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA12 | NA | RP-HPLC–MS/MS | NA | 996.5 | 22.8ug protein/ml |
| FMDB1531 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA21 | NA | RP-HPLC–MS/MS | NA | 996.5 | 19.5ug protein/ml |
| FMDB1532 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA53 | NA | RP-HPLC–MS/MS | NA | 996.5 | 24.8ug protein/ml |
| FMDB1533 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA127 | NA | RP-HPLC–MS/MS | NA | 996.5 | 20.8ug protein/ml |
| FMDB1534 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QF386 | NA | RP-HPLC–MS/MS | NA | 996.5 | 21.4ug protein/ml |
| FMDB1535 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QM38 | NA | RP-HPLC–MS/MS | NA | 996.5 | 17.8ug protein/ml |
| FMDB1536 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis SDM37 | NA | RP-HPLC–MS/MS | NA | 996.5 | 25.1ug protein/ml |
| FMDB1537 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis SDP10 | NA | RP-HPLC–MS/MS | NA | 996.5 | 26.3ug protein/ml |
| FMDB1538 | 23845432 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis SMF54. | NA | RP-HPLC–MS/MS | NA | 996.5 | 27.3ug protein/ml |
| FMDB1539 | 23845432 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Skimmed Milk | β-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis CGV67 | NA | RP-HPLC–MS/MS | NA | 1037.4 | 24.9ug protein/ml |
| FMDB1543 | 23845432 | NA | NA | LLRF | LLRF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis BCS27 | NA | RP-HPLC–MS/MS | NA | 547.4 | 28.4ug protein/ml |
| FMDB1544 | 23845432 | NA | NA | LLRF | LLRF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA12 | NA | RP-HPLC–MS/MS | NA | 547.4 | 22.8ug protein/ml |
| FMDB1545 | 23845432 | NA | NA | LLRF | LLRF | 4 | Skimmed Milk | αS1-Casein | NA | 37c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay by using fluorescence substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | E. faecalis QA21 | NA | RP-HPLC–MS/MS | NA | 547.4 | 19.5ug protein/ml |
| FMDB1574 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | KEMPFPKYPVE | KEMPFPKYPVE | 11 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 682.840 +2 | 1363.68 | NA |
| FMDB1575 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | WMHQPPQPLPPTVMFPPQSVL | WMHQPPQPLPPTVMFPPQSVL | 21 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1214.088+2 | 2426.18 | NA |
| FMDB1576 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | MHQPPQPLPPTVMFPPQSVL | MHQPPQPLPPTVMFPPQSVL | 20 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1121.057+2 | 2240.11 | NA |
| FMDB1577 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | HQPPQPLPPTVMFPPQSVL | HQPPQPLPPTVMFPPQSVL | 19 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1055.544+2 | 2109.09 | NA |
| FMDB1578 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQEPVLGPVRGPFPI | YQEPVLGPVRGPFPI | 15 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 834.880 +2 | 1667.76 | NA |
| FMDB1579 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | QEPVLGPVRGPFPILV | QEPVLGPVRGPFPILV | 16 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 859.491 +2 | 1716.98 | NA |
| FMDB1580 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | QEPVLGPVRGPFPI | QEPVLGPVRGPFPI | 14 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 753.416 +2 | 1504.83 | NA |
| FMDB1581 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | PVLGPVRGPFPI | PVLGPVRGPFPI | 12 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 624.847+ 2 | 1247.69 | NA |
| FMDB1582 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | LGPVRGPFPI | LGPVRGPFPI | 10 | WSE of Roquefort type cheese | β-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 526.808 +2 | 1051.61 | NA |
| FMDB1583 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | TDAPSFSDIPNPIGSENSGK | TDAPSFSDIPNPIGSENSGK | 20 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1016.976+2 | 2031.95 | NA |
| FMDB1584 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | DIPNPIGSENSGKTTMPLW | DIPNPIGSENSGKTTMPLW | 19 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 1028.993+2 | 2055.98 | NA |
| FMDB1585 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | IPNPIGSENSGKIT | IPNPIGSENSGKIT | 14 | WSE of Roquefort type cheese | αS1-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 713.872 +2 | 1425.74 | NA |
| FMDB1586 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | NAGPFTPTVNR | NAGPFTPTVNR | 11 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 587.320 +2 | 1172.62 | NA |
| FMDB1587 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQGPIVLNPWDQVKR | YQGPIVLNPWDQVKR | 15 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 604.993+ 3 | 1811.96 | NA |
| FMDB1588 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | YQGPIVLNPWDQVK | YQGPIVLNPWDQVK | 14 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 828.895 +2 | 1655.78 | NA |
| FMDB1589 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | GPIVLNPWDQVKR | GPIVLNPWDQVKR | 13 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 761.428+ 2 | 1520.86 | NA |
| FMDB1590 | NA | meira12 | Bioactive peptides in water-soluble extracts of ovine cheeses from Southern Brazil and Uruguay | VLNPWDQVKR | VLNPWDQVKR | 10 | WSE of Roquefort type cheese | αS2-Casein | NA | 31-33 c coking temp. | 90days of ripening | Anti-hypertensive;Antioxidant | In vitro | NA | spectrophotometric assay using HHL as substrate and DPPH radical scavenging activity | NA | NA | nano-ESI tandem mass spectrometry (MS/MS) | 627.840 +2 | 1253.68 | NA |
| FMDB1592 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | VRGP | VRGP | 4 | WSE of commercial goat cheese | β-Casein | NA | NA | 2month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 428.2 | 120.9µM |
| FMDB1596 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | DKIHP | DKIHP | 5 | WSE of commercial goat cheese | β-Casein | NA | NA | 2month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 609.2 | 113.1µM |
| FMDB1598 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | DKIHPF | DKIHPF | 6 | WSE of commercial goat cheese | β-Casein | NA | NA | 2month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 756.3 | 2419.4µM |
| FMDB1599 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | QP | QP | 2 | WSE of commercial goat cheese | Various fragments | NA | NA | 2month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 244 | 598.1µM |
| FMDB1600 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | PP | PP | 2 | WSE of commercial goat cheese | Various fragments | NA | NA | 2month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 212.9 | 2284.7µM |
| FMDB1609 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | PP | PP | 2 | WSE of commercial Cabrales cheese ( cow Milk + Ewe Milk + goat Milk ) | Various fragments | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 212.9 | 2284.7µM |
| FMDB1615 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | DKIHP | DKIHP | 5 | WSE of commercial Cabrales cheese ( cow Milk + Ewe Milk + goat Milk ) | β-Casein | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 609.2 | 113.1µM |
| FMDB1618 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | DKIHPF | DKIHPF | 6 | WSE of commercial Cabrales cheese ( cow Milk + Ewe Milk + goat Milk ) | β-Casein | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 756.3 | 2419.4µM |
| FMDB1622 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | DKIHP | DKIHP | 5 | WSE of commercial manchego cheese ( ewe's Milk) | β-Casein | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 609.2 | 113.1µM |
| FMDB1623 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | DKIHPF | DKIHPF | 6 | WSE of commercial manchego cheese ( ewe's Milk) | β-Casein | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 756.3 | 2419.4µM |
| FMDB1625 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | QP | QP | 2 | WSE of commercial manchego cheese ( ewe's Milk) | Various fragments | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 244 | 598.1µM |
| FMDB1626 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | PP | PP | 2 | WSE of commercial manchego cheese ( ewe's Milk) | Various fragments | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 212.9 | 2284.7µM |
| FMDB1627 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | FP | FP | 2 | WSE of commercial manchego cheese ( ewe's Milk) | Various fragments | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 263 | 1215.7µM |
| FMDB1628 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | PFP | PFP | 3 | WSE of commercial manchego cheese ( ewe's Milk) | Various fragments | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 360.1 | 144.4µM |
| FMDB1629 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | QP | QP | 2 | WSE of roncal cheese | Various fragments | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 244 | 598.1µM |
| FMDB1630 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | PP | PP | 2 | WSE of roncal cheese | Various fragments | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 212.9 | 2284.7µM |
| FMDB1631 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | HPIK | HPIK | 4 | WSE of roncal cheese | αS1-Casein | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 494.2 | NA |
| FMDB1633 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | DKIHP | DKIHP | 5 | WSE of roncal cheese | β-Casein | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 609.2 | 113.1µM |
| FMDB1634 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | DKIHPF | DKIHPF | 6 | WSE of roncal cheese | β-Casein | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 756.3 | 2419.4µM |
| FMDB1636 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | PKHP | PKHP | 4 | WSE of roncal cheese | αS1-Casein | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 478.2 | 709.1µM |
| FMDB1638 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | QP | QP | 2 | WSE of Idiaz´abal cheese ( Ovine Milk) | Various fragments | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 244 | 598.1µM |
| FMDB1639 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | FP | FP | 2 | WSE of Idiaz´abal cheese ( Ovine Milk) | Various fragments | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 263 | 1215.7µM |
| FMDB1645 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | DKIHP | DKIHP | 5 | WSE of Idiaz´abal cheese ( Ovine Milk) | β-Casein | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 609.2 | 113.1µM |
| FMDB1647 | NA | ruiz06 | Identification of ACE-inhibitory peptides in different Spanish cheeses by tandem mass spectrometry | DKIHPF | DKIHPF | 6 | WSE of Idiaz´abal cheese ( Ovine Milk) | β-Casein | NA | NA | 4month old | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | NA | NA | RP-HPLC-MS/MS and off-line ESI-MS/MS | NA | 756.3 | 2419.4µM |
| FMDB1648 | Rizello 2005 | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | GLSPEVLNENLL | GLSPEVLNENLL | 12 | WSE of Pecorino Romano cheese | Sheep αS1- Casein | 5.3 | 45-46C cooking ; ripenin 10mo | 10monthold | Antibacterial | In vitro | NA | NA | natural culture in scotta | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1297.6 | NA | |
| FMDB1649 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | RFVVAPFPE | RFVVAPFPE | 9 | WSE of Pecorino Romano cheese | Sheep αS1-Casein | 5.3 | 45-46C cooking ; ripenin 10mo | 10monthold | Antibacterial | In vitro | NA | NA | natural culture in scotta | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1061.7 | NA | |
| FMDB1650 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | VVAPFPEV | VVAPFPEV | 8 | WSE of Pecorino Romano cheese | Sheep αS1-Casein | 5.3 | 45-46C cooking ; ripenin 10mo | 10monthold | Antibacterial | In vitro | NA | NA | natural culture in scotta | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 857.5 | NA | |
| FMDB1651 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | VMFPPQSVL | VMFPPQSVL | 9 | WSE of Pecorino Romano cheese | Sheep β-Casein | 5.3 | 45-46C cooking ; ripenin 10mo | 10monthold | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural culture in scotta | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1017.4 | NA | |
| FMDB1652 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | MAIPPKKNQD | MAIPPKKNQD | 10 | WSE of Canestrato Pugliese cheese | Cow k-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1141.5 | NA | |
| FMDB1653 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | TVQVTSTAV | TVQVTSTAV | 9 | WSE of Canestrato Pugliese cheese | Cow k-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 905.3 | NA | |
| FMDB1654 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | MPIQAF | MPIQAF | 6 | WSE of Canestrato Pugliese | Sheep β-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 706.4 | NA | |
| FMDB1655 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | FVAPFPEVFG | FVAPFPEVFG | 10 | WSE of Canestrato Pugliese | cow αS1-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1109.5 | NA | |
| FMDB1656 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | GKEKVNELSKD | GKEKVNELSKD | 11 | WSE of Canestrato Pugliese cheese | cow αS1-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1246.7 | NA | |
| FMDB1657 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | FVAPFPEVFG | FVAPFPEVFG | 10 | WSE of Canestrato Pugliese cheese | cow αS1-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1109.5 | NA | |
| FMDB1658 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | RPKHPIK | RPKHPIK | 7 | WSE of Caciocavallo | cow αS1-Casein | 5.2 | stretching at 90-95C | 3 monthold ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Milk culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 875.6 | NA | |
| FMDB1659 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | GLPQE | GLPQE | 5 | WSE of Caciocavallo cheese | cow αS1-Casein | 5.2 | stretching at 90-95C | 4 monthold ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Milk culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 543.1 | NA | |
| FMDB1660 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | MAIPPKKNQD | MAIPPKKNQD | 10 | WSE of Crescenza cheese | Cow k-Casein | 5.6 | NA | 7days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | freeze dried culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1141.5 | NA | |
| FMDB1661 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | WSE of Crescenza | Cow β-Casein | 5.6 | NA | 7days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | freeze dried culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1881.3 | NA | |
| FMDB1662 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | MPIQAFLL | MPIQAFLL | 8 | WSE of Crescenza cheese | Cow β-Casein | 5.6 | NA | 7days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | freeze dried culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 932.5 | NA | |
| FMDB1663 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | FVAPFPEVFG | FVAPFPEVFG | 10 | WSE of Crescenza cheese | cow αS1-Casein | 5.6 | NA | 7days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | freeze dried culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1109.4 | NA | |
| FMDB1664 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Crescenza cheese | cow αS1-Casein | 5.6 | NA | 7days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | freeze dried culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1052.7 | NA | |
| FMDB1665 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | YPFTGPIPN | YPFTGPIPN | 9 | WSE of Caprino del piemonte cheese | Goat β-Casein | 4.7 | NA | 30days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | NA | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1005.5 | NA | |
| FMDB1666 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | MPIQA | MPIQA | 5 | WSE of Caprino del piemonte | Goat β-Casein | 4.7 | NA | 30days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | NA | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 559.2 | NA | |
| FMDB1667 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | VFMFPPQSV | VFMFPPQSV | 9 | WSE of Caprino del piemonte cheese | Goat β-Casein | 4.7 | NA | 30days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | NA | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 904.4 | NA | |
| FMDB1668 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | VVAPFPE | VVAPFPE | 7 | WSE of Caprino del piemonte cheese | Goat αS1-Casein | 4.7 | NA | 30days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | NA | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 758.4 | NA | |
| FMDB1669 | NA | ronquillo12 | Antithrombotic and angiotensin-converting enzyme inhibitory properties of peptides released from bovine Casein by Lactobacillus casei Shirota | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein medium | Bovine ( β-Casein) | 9 | 37c | 42h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | Lb. casei Shirota and St. thermophilus | NA | MALDI-TOF/TOF MS | NA | 1.88 Kda | IER value of 0.14%/peptide concentration (mg/mL) |
| FMDB1670 | NA | Antithrombotic and angiotensin-converting enzyme inhibitory properties of peptides released from bovine Casein by Lactobacillus casei Shirota | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein medium | Bovine ( β-Casein) | 9 | 37c | 42h | Antithrombotic | In vitro | NA | Thrombin inhibition assay | Lb. casei Shirota | NA | MALDI-TOF/TOF MS | NA | 1.88 Kda | IER of thrombin with 4.6%/peptide concentration (mg/ mL) | |
| FMDB1818 | 15328207 | Structural Analysis of a New Anti-Hypertensive Peptide (β-Lactosin B) Isolated from a Commercial Whey Product | ALPM “β-lactosin B” | ALPM | 5 | commercial Whey product, WE80BG | β-lactoglobulin | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophometric assay using HHL as substrate | NA | NA | RPHPLC and N terminal sequencing by Edman degradation | NA | NA | 928uM | |
| FMDB1820 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FVAPFPE | FVAPFPE | 7 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 806.388+1 | 805.372 | NA |
| FMDB1821 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VAPFP | VAPFP | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 530.179+1 | 529.172 | NA |
| FMDB1822 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VAPFPE | VAPFPE | 6 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 659.312+1 | 658.304 | NA |
| FMDB1832 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LGTQY | LGTQY | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 581.257+1 | 580.25 | NA |
| FMDB1833 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | DIPNP | DIPNP | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 555.344+1 | 554.337 | NA |
| FMDB1838 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | AVPITPT | AVPITPT | 7 | Casein ( proMilk 85) | αS2-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 698.394+1 | 697.386 | NA |
| FMDB1839 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | PITPT | PITPT | 5 | Casein ( proMilk 85) | αS2-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 528.248+1 | 527.24 | NA |
| FMDB1840 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | TKVIPY | TKVIPY | 6 | Casein ( proMilk 85) | αS2-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 720.417+1 | 719.409 | NA |
| FMDB1843 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VYPFP | VYPFP | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 622.309+1 | 621.302 | NA |
| FMDB1844 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IPPL | IPPL | 4 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 439.026+1 | 438.018 | NA |
| FMDB1849 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LHLPLP | LHLPLP | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 689.449+1 | 688.442 | 425 ± 44 uM |
| FMDB1850 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | HLPLP | HLPLP | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 576.304+1 | 575.297 | NA |
| FMDB1852 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VMFPPQS | VMFPPQS | 7 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 805.351+1 | 804.343 | NA |
| FMDB1857 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FVAPFPE | FVAPFPE | 7 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 805.399+1 | 805.378 | NA |
| FMDB1876 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IPPLTQTP | IPPLTQTP | 8 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 866.472 | 865.465 | NA |
| FMDB1878 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VSKVKE | VSKVKE | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 689.313 | 688.395 | NA |
| FMDB1884 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FTESQS | FTESQS | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 698.269 | 697.262 | NA |
| FMDB1885 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LTLTDVEN | LTLTDVEN | 8 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 904.446 | 903.439 | NA |
| FMDB1886 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LHLPLP | LHLPLP | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 689.313 | 688.392 | NA |
| FMDB1889 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | HLPLP | HLPLP | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 576.334 | 575.327 | NA |
| FMDB1891 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LPLPLLQS | LPLPLLQS | 8 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 880.515 | 879.508 | NA |
| FMDB1895 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VMFPPQS | VMFPPQS | 7 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 805.402 | 804.348 | NA |
| FMDB1898 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | MPIQA | MPIQA | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 559.253 | 558.246 | NA |
| FMDB1901 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | GPVRGPFP | GPVRGPFP | 8 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 826.445 | 825.438 | NA |
| FMDB1902 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | GPVRGPFPI | GPVRGPFPI | 9 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 939.5 | 938.493 | NA |
| FMDB1904 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | SPPEINT | SPPEINT | 7 | Casein ( proMilk 85) | k-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 757.362 | 756.355 | NA |
| FMDB1905 | NA | tsai08 | Antihypertensive effect of bioactive peptides produced by protease-facilitated lactic acid fermentation of Milk | YPYY | YPYY | 4 | Fermented Milk Whey product (4.5% (w/v) skimmed Milk powder, 5.5% (w/v) whole Milk powder and 7% (w/v) sucrose ) | Casein | NA | 43c | 5h | Ace-inhibitory | In vitro | NA | RP-HPLC modified spectrophotometric assay using HHL as substrate | Streptococcus thermophilus and Lactobacillus bulgaricus + . Flavourzyme from Aspergillus oryzae | protease | RP-HPLC and protein sequencer 492 Procise | NA | NA | 90.9uM |
| FMDB1966 | NA | amadou13 | Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activities | SGYYMH | SGYYMH | 6 | defatted foxtail millet meal | NA | NA | 37c | 48h | Antioxidant | In vitro | NA | DPPH scavenging activityand the superoxide anion (O2 •−) scavenging activity | L. paracasei Fn032 | NA | HPLC MALDI–TOF–TOF MS | NA | 756.84 da | NA |
| FMDB1967 | NA | amadou13 | Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activities | LGTFQN | LGTFQN | 6 | defatted foxtail millet meal | NA | NA | 37c | 48h | Antioxidant | In vitro | NA | DPPH scavenging activityand the superoxide anion (O2 •−) scavenging activity | L. paracasei Fn032 | NA | HPLC MALDI–TOF–TOF MS | NA | 678.74 Da | NA |
| FMDB1968 | NA | amadou13 | Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activities | LHALLL | LHALLL | 6 | defatted foxtail millet meal | NA | NA | 37c | 48h | Antioxidant | In vitro | NA | DPPH scavenging activityand the superoxide anion (O2 •−) scavenging activity | L. paracasei Fn032 | NA | HPLC MALDI–TOF–TOF MS | NA | 678.87 Da | NA |
| FMDB1969 | NA | amadou13 | Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activities | SGYYMH | SGYYMH | 6 | defatted foxtail millet meal | NA | NA | 37c | 48h | Anti-microbial against E. coli ATCC 8099 | In vitro | NA | well diffusion assay | L. paracasei Fn032 | NA | HPLC MALDI–TOF–TOF MS | NA | 756.84 da | NA |
| FMDB1970 | NA | amadou13 | Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activities | LGTFQN | LGTFQN | 6 | defatted foxtail millet meal | NA | NA | 37c | 48h | Anti-microbial against E. coli ATCC 8099 | In vitro | NA | well diffusion assay | L. paracasei Fn032 | NA | HPLC MALDI–TOF–TOF MS | NA | 678.74 Da | NA |
| FMDB1971 | NA | amadou13 | Purification and characterization of foxtail millet-derived peptides with antioxidant and antimicrobial activities | LHALLL | LHALLL | 6 | defatted foxtail millet meal | NA | NA | 37c | 48h | Anti-microbial against E. coli ATCC 8099 | In vitro | NA | well diffusion assay | L. paracasei Fn032 | NA | HPLC MALDI–TOF–TOF MS | NA | 678.87 Da | NA |
| FMDB1972 | 19619856 | NA | NA | IPP | IPP | 3 | Casein miso paste (sodium Caseinate (24%: w/w), rice koji (20.9%: w/w), salt (10.8%: w/w), S.cerevisiae (0.1%: w/w) and water (3.1%: w/w) | Casein | NA | 30c | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | A.oryzae in rice koji +Saccharomyces cerevisiae | proteinase and peptidase | LC-MS | NA | NA | NA |
| FMDB1973 | 19619856 | NA | NA | VPP | VPP | 3 | Casein miso paste (sodium Caseinate (24%: w/w), rice koji (20.9%: w/w), salt (10.8%: w/w), S.cerevisiae (0.1%: w/w) and water (3.1%: w/w) | Casein | NA | 30c | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | A.oryzae in rice koji +Saccharomyces cerevisiae | proteinase and peptidase | LC-MS | NA | NA | NA |
| FMDB1976 | 12843654 | NA | NA | IFL | IFL | 3 | Tofuyo | Alpha &beta subunit of beta con Glycinin ( 476-478) & ( 247-249) | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | A.oryzae or/M.purpureus | proteases | automated Edman degardation with a gas/liquid phase protein sequencer | NA | NA | 44.8uM |
| FMDB1977 | 12843654 | NA | NA | WL | WL | 2 | Tofuyo | B-B1A-&BX subunit of Glycinin ( 44-45) and (43-44) | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | A.oryzae or/M.purpureus | proteases | automated Edman degardation with a gas/liquid phase protein sequencer | NA | NA | 29.9uM |
| FMDB1978 | 12843654 | NA | NA | VLSLSQPKVLPVPQKAVPQ | VLSLSQPKVLPVPQKAVPQ | 19 | Skim Milk | β-Casein | NA | 38C | 20h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactobacillus acidophilus, Lactobacillus helveticus and Saccharomyces cerevisiae | NA | MALDITOF-MS | 2029.4893 | NA | NA |
| FMDB1987 | 12358510 | NA | NA | VY | VY | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 35.2uM |
| FMDB1988 | 12358510 | NA | NA | IY | IY | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 6.1uM |
| FMDB1989 | 12358510 | NA | NA | AW | AW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 18.8uM |
| FMDB1990 | 12358510 | NA | NA | FY | FY | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 42.3uM |
| FMDB1991 | 12358510 | NA | NA | VW | VW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 3.3uM |
| FMDB1992 | 12358510 | NA | NA | IW | IW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 1.5uM |
| FMDB1993 | 12358510 | NA | NA | LW | LW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 23.6uM |
| FMDB1994 | 19994857 | NA | NA | AW | AW | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 10 microM |
| FMDB1995 | 19994857 | NA | NA | GW | GW | 2 | Fermented soyabean seasoning | NA | NA | 26 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 30 microM |
| FMDB1996 | 19994857 | NA | NA | AY | AY | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 48 microM |
| FMDB1997 | 19994857 | NA | NA | SY | SY | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 67 microM |
| FMDB1998 | 19994857 | NA | NA | GY | GY | 2 | Fermented soyabean seasoning | NA | NA | NA | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 97 microM |
| FMDB1999 | 19994857 | NA | NA | AF | AF | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 190 microM |
| FMDB2000 | 19994857 | NA | NA | VP | VP | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 480 microM |
| FMDB2001 | 19994857 | NA | NA | AI | AI | 2 | Fermented soyabean seasoning | NA | NA | NA | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | SHR | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 690 microM |
| FMDB2002 | 19994857 | NA | NA | VG | VG | 2 | Fermented soyabean seasoning | NA | NA | 25 to 40C | Steamed soyabean and raosted wheat inoculated with seed starter and cultivated for 3 days called Shoyu koji and then to it puffed soyabean was added in brine. The product called Moromi was then fermented for 5 days at 45 C | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit and Spectrophotometric assay using HHL as substate | Tane koji, rich in conidia of A. sojae | NA | LC-MS/MS | NA | NA | 1100 microM |
| FMDB2003 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 7.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60208 or H9) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2004 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 7.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60208 or H9) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2005 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30046) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2006 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30046) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2007 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 34.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60205) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2008 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 32.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU10142) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2009 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 32.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU10142) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2010 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 15.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30005) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2011 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 15.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30005) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2012 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60207) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2013 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60207) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2014 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60210) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2015 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60210) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2016 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60211) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2017 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60211) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2018 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60204) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2019 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60204) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2020 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50010) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2021 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60201) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2022 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60201) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2023 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 24.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60220) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2024 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60066) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2025 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60066) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2026 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.2h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60212) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2027 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.2h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60212) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2028 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50151) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2029 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50151) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2030 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60117) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2031 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60117) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2032 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30003) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2033 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30003) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2034 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 23h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30023) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2035 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 42.4h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50061) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2036 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30134) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2037 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30134) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2038 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 14.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60206) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2039 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 14.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60206) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2040 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50011) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2041 | NA | ahn09 | ANGIOTENSIN I-CONVERTING ENZYME (ACE) INHIBITORY PEPTIDES FROM WHEY FERMENTED BY LACTOBACILLUS SPECIES | AEKTK | AEKTK | 5 | Reconstituted Whey powder | b-lactoglobulin f73–77 | 6 | 37C | 36h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lb. brevisKCTC3102 | NA | RP-HPLc and soild phase Edman peptide sequencing | NA | NA | 509.1± 0.000ug/ml |
| FMDB2042 | NA | ahn09 | ANGIOTENSIN I-CONVERTING ENZYME (ACE) INHIBITORY PEPTIDES FROM WHEY FERMENTED BY LACTOBACILLUS SPECIES | AQSAP | AQSAP | 5 | Reconstituted Whey powder | b-lactoglobulin f34–38 | 6 | 37C | 36h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lb. helveticus ATCC 15009 | NA | RP-HPLc and soild phase Edman peptide sequencing | NA | NA | 238.6 ±49.20ug/ml |
| FMDB2043 | NA | ahn09 | ANGIOTENSIN I-CONVERTING ENZYME (ACE) INHIBITORY PEPTIDES FROM WHEY FERMENTED BY LACTOBACILLUS SPECIES | IPAVF | IPAVF | 5 | Reconstituted Whey powder | b-lactoglobulin f78–82 | 6 | 37C | 36h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lb. helveticus ATCC 15009 | NA | RP-HPLc and soild phase Edman peptide sequencing | NA | NA | 5.3 ±0.100ug/ml |
| FMDB2044 | NA | ahn09 | ANGIOTENSIN I-CONVERTING ENZYME (ACE) INHIBITORY PEPTIDES FROM WHEY FERMENTED BY LACTOBACILLUS SPECIES | APLRV | APLRV | 5 | Reconstituted Whey powder | b-lactoglobulin f37–41 | 6 | 37C | 36h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lb. helveticus ATCC 15009 | NA | RP-HPLc and soild phase Edman peptide sequencing | NA | NA | 5.3 ±0.100ug/ml |
| FMDB2045 | NA | ahn09 | ANGIOTENSIN I-CONVERTING ENZYME (ACE) INHIBITORY PEPTIDES FROM WHEY FERMENTED BY LACTOBACILLUS SPECIES | AHKAL | AHKAL | 5 | Reconstituted Whey powder | α-LA f106–110 | 6 | 37C | 36h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lb. helveticus ATCC 15009 | NA | RP-HPLc and soild phase Edman peptide sequencing | NA | NA | 5.3 ±0.100ug/ml |
| FMDB2065 | 12957917 | NA | NA | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Bovine Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2100.28 | 57.2ug/ml |
| FMDB2066 | 12957917 | NA | NA | FVAPFPEVFGKEKVNELSKDIGSE | FVAPFPEVFGKEKVNELSKDIGSE | 24 | Bovine Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2194.35 | 57.2ug/ml |
| FMDB2067 | 12957917 | NA | NA | LGTQYTDAPSFSDIPNPIGSENSEK | LGTQYTDAPSFSDIPNPIGSENSEK | 25 | Bovine Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2122.27 | 57.2ug/ml |
| FMDB2068 | 12957917 | NA | NA | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Bovine Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2100.28 | 16.2ug/ml |
| FMDB2069 | 12957917 | NA | NA | FVAPFPEVFGKEKVNELSKDIGSE | FVAPFPEVFGKEKVNELSKDIGSE | 24 | Bovine Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2194.35 | 16.2ug/ml |
| FMDB2070 | 12957917 | NA | NA | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Bovine Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2100.28 | 23.9ug/ml |
| FMDB2071 | 12957917 | NA | NA | RPKHPI | RPKHPI | 6 | sheep Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 746.9 | 120.2ug/ml |
| FMDB2072 | 12957917 | NA | NA | RPKH | RPKH | 4 | sheep Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 537.32 | 120.2ug/ml |
| FMDB2073 | 12957917 | NA | NA | HPIKH | HPIKH | 5 | sheep Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 631.37 | 120.2ug/ml |
| FMDB2074 | 12957917 | NA | NA | TVDQ | TVDQ | 4 | sheep Milk sodium Caseinate | αS2-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 599.42 | 786ug/ml |
| FMDB2075 | 12957917 | NA | NA | HQK | HQK | 3 | sheep Milk sodium Caseinate | αS2-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 411.46 | 786ug/ml |
| FMDB2076 | 12957917 | NA | NA | LVYPFPGP | LVYPFPGP | 8 | goat Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 888.47 | 147.3ug/ml |
| FMDB2077 | 12957917 | NA | NA | TVDQHQ | TVDQHQ | 6 | goat Milk sodium Caseinate | αS2-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 727.33 | 210.5ug/ml |
| FMDB2078 | 12957917 | NA | NA | LVYPFPGPI | LVYPFPGPI | 9 | Buffalo Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 1002.14 | 112.6ug/ml |
| FMDB2079 | 12957917 | NA | NA | QPQ | QPQ | 3 | Human Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 371.26 | 228.1ug/ml |
| FMDB2080 | 12957917 | NA | NA | VPQ | VPQ | 3 | Human Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 342.26 | 228.1ug/ml |
| FMDB2081 | 12957917 | NA | NA | IPQ | IPQ | 3 | Human Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 356.36 | 228.1ug/ml |
| FMDB2082 | 12957917 | NA | NA | QELLLNPTHQYPVTQPLAPVHNPISV | QELLLNPTHQYPVTQPLAPVHNPISV | 26 | Human Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Antibacterial against Enterococcus faecium;Bacillus megaterium;Escherichia coli;Listeria innocua;Salmonella spp.;Yersinia enterocolitica;;Staphylococcus aureus | In vitro | NA | well diffusion assay | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 3132.8 | NA |
| FMDB2090 | 23871374;15030202 | NA | NA | VLSLSQSKVLPVPQK | VLSLSQSKVLPVPQK | 15 | Casein | β-Casein | 7 | 37c | 48h | Antioxidant | In vitro | NA | ABTS radical scavenging activity and total phenolic content measurement | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 541.6613+3 | 1621.9622 | NA |
| FMDB2092 | 23871374;15030202 | NA | NA | VLSLSQSKVLPVPQKAVPYPQRDMPIQA | VLSLSQSKVLPVPQKAVPYPQRDMPIQA | 28 | Casein | β-Casein | 7 | 37c | 48h | Antioxidant | In vitro | NA | ABTS radical scavenging activity and total phenolic content measurement | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 777.1820+4 | 3104.699 | NA |
| FMDB2119 | NA | NA | NA | VKEAMAPK | VKEAMAPK | 8 | Cheddar cheese | β-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus casei ssp. casei 300 | NA | LC-MS/MS | NA | 872.5048 | NA |
| FMDB2120 | NA | NA | NA | HIQKEDVPSER | HIQKEDVPSER | 11 | Cheddar cheese | αS1-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus casei ssp. casei 300 | NA | LC-MS/MS | NA | 1336.7034 | NA |
| FMDB2121 | NA | NA | NA | ARHPHPHLSFM | ARHPHPHLSFM | 11 | Skimmed Milk | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus IFO13953 | NA | mass spectrograph & amino acid sequencer | NA | NA | NA |
| FMDB2167 | 15537298 | NA | NA | LHLPLPLL | LHLPLPLL | 8 | sodium Caseinate | β-Casein | NA | 37C | 1 and 2h | Ace-inhibitory | In vitro | NA | spectrophotometric method using FAPGG as substrate | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 916.2 da | NA |
| FMDB2168 | 15537298 | NA | NA | NLHLPLPLL | NLHLPLPLL | 9 | sodium Caseinate | β-Casein | NA | 37C | 1 and 2h | Ace-inhibitory | In vitro | NA | spectrophotometric method using FAPGG as substrate | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 1030.3 da | 15uM |
| FMDB2169 | 15537298 | NA | NA | VENLHLPLPL | VENLHLPLPL | 10 | sodium Caseinate | β-Casein | NA | 37C | 1 and 2h | Ace-inhibitory | In vitro | NA | spectrophotometric method using FAPGG as substrate | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 1145.4 da | NA |
| FMDB2170 | 15537298 | NA | NA | DVENLHLPLPLLQSW | DVENLHLPLPLLQSW | 15 | sodium Caseinate | β-Casein | NA | 37C | 1 and 2h | Ace-inhibitory | In vitro | NA | spectrophotometric method using FAPGG as substrate | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 1775.1 da | NA |
| FMDB2171 | 15537298 | NA | NA | KYPVEPFTESQSLTLTDVENLHL | KYPVEPFTESQSLTLTDVENLHL | 23 | sodium Caseinate | β-Casein | NA | 37C | 1 and 2h | Ace-inhibitory | In vitro | NA | spectrophotometric method using FAPGG as substrate | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 2662 da | NA |
| FMDB2172 | 15537298 | NA | NA | FVAPFPEVFGKEKVNELSKDIGS | FVAPFPEVFGKEKVNELSKDIGS | 23 | sodium Caseinate | αS1-Casein | NA | 37C | 1 and 2h | Ace-inhibitory | In vitro | NA | spectrophotometric method using FAPGG as substrate | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 2538.9 da | NA |
| FMDB2173 | 15537298 | NA | NA | NENLLRFFVAPFPE | NENLLRFFVAPFPE | 14 | sodium Caseinate | αS1-Casein | NA | 37C | 1 and 2h | Ace-inhibitory | In vitro | NA | spectrophotometric method using FAPGG as substrate | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 1692.8 da | 55uM |
| FMDB2174 | 15537298 | NA | NA | LGPVRGPFPI | LGPVRGPFPI | 10 | sodium Caseinate | β-Casein | NA | 37C | 1 and 2h | Ace-inhibitory | In vitro | NA | spectrophotometric method using FAPGG as substrate | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 1053.3 da | NA |
| FMDB2175 | 15537298 | NA | NA | QKAVPYPQRDMPI | QKAVPYPQRDMPI | 13 | sodium Caseinate | β-Casein | NA | 37C | 1 and 2h | Ace-inhibitory | In vitro | NA | spectrophotometric method using FAPGG as substrate | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 1543.8 da | NA |
| FMDB2176 | 15537298 | NA | NA | LPQYLKTVYQHQKA | LPQYLKTVYQHQKA | 14 | sodium Caseinate | αS2-Casein | NA | 37C | 1 and 2h | Ace-inhibitory | In vitro | NA | spectrophotometric method using FAPGG as substrate | Lactobacillus (Lb.) helveticus NCC 2765 | NA | ESI-MS/ MS | NA | 1718 da | NA |
| FMDB2178 | NA | gibbs04 | Production and characterization of bioactive peptides from soy hydrolysate and soy-fermented food. | QPQQRGQSSRP | QPQQRGQSSRP | 11 | Natto | Glycinin | NA | 38c | 24h | Ace-inhibitory | In vitro | NA | NA | B.subtilis ATCC 21332 | NA | NA | NA | NA | 0.2± 0.1uM |
| FMDB2179 | NA | gibbs04 | Production and characterization of bioactive peptides from soy hydrolysate and soy-fermented food. | QPQQRGQSSRP | QPQQRGQSSRP | 11 | Natto | Glycinin | NA | 38c | 24h | Antithrombotic | In vitro | NA | NA | B.subtilis ATCC 21332 | NA | NA | NA | NA | 162.1±1.1uM |
| FMDB2180 | NA | gibbs04 | Production and characterization of bioactive peptides from soy hydrolysate and soy-fermented food. | GQTSSPDIYNP | GQTSSPDIYNP | 11 | Natto | Glycinin | NA | 38c | 24h | Ace-inhibitory | In vitro | NA | NA | B.subtilis ATCC 21332 | NA | NA | NA | NA | 40.0± 0.1uM |
| FMDB2181 | NA | gibbs04 | Production and characterization of bioactive peptides from soy hydrolysate and soy-fermented food. | GQTSSPDIYNP | GQTSSPDIYNP | 11 | Natto | Glycinin | NA | 38c | 24h | Antithrombotic | In vitro | NA | NA | B.subtilis ATCC 21332 | NA | NA | NA | NA | 76.6±1.1uM |
| FMDB2182 | NA | gibbs04 | Production and characterization of bioactive peptides from soy hydrolysate and soy-fermented food. | KGKDKHCQRP | KGKDKHCQRP | 10 | Natto | Glycinin | NA | 38c | 24h | Ace-inhibitory | In vitro | NA | NA | B.subtilis ATCC 21332 | NA | NA | NA | NA | 8.7±O.6uM |
| FMDB2183 | NA | gibbs04 | Production and characterization of bioactive peptides from soy hydrolysate and soy-fermented food. | KGKDKHCQRP | KGKDKHCQRP | 10 | Natto | Glycinin | NA | 38c | 24h | Antithrombotic | In vitro | NA | NA | B.subtilis ATCC 21332 | NA | NA | NA | NA | 36.2±1.6uM |
| FMDB2184 | NA | gibbs04 | Production and characterization of bioactive peptides from soy hydrolysate and soy-fermented food. | QARQIKNNNP | QARQIKNNNP | 10 | Natto | Glycinin | NA | 38c | 24h | Ace-inhibitory | In vitro | NA | NA | B.subtilis ATCC 21332 | NA | NA | NA | NA | 14.2±1.5uM |
| FMDB2185 | NA | gibbs04 | Production and characterization of bioactive peptides from soy hydrolysate and soy-fermented food. | QARQIKNNNP | QARQIKNNNP | 10 | Natto | Glycinin | NA | 38c | 24h | Antithrombotic | In vitro | NA | NA | B.subtilis ATCC 21332 | NA | NA | NA | NA | 85.4±0.9uM |
| FMDB2186 | 23642310 | NA | NA | TASSVASTTK | TASSVASTTK | 10 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 952.217 da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2187 | 23642310 | NA | NA | TIKATKT | TIKATKT | 7 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 762.272da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2188 | 23642310 | NA | NA | MLAAKSSAAST | MLAAKSSAAST | 11 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 1037.511da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2189 | 23642310 | NA | NA | VSSGAEIAKI | VSSGAEIAKI | 10 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 973.687da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2190 | 23642310 | NA | NA | NQMLAAKSSAAS | NQMLAAKSSAAS | 12 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 1178.621da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2191 | 23642310 | NA | NA | VINIVLAAV | VINIVLAAV | 9 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 911.725da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2192 | 23642310 | NA | NA | ENGNTLSG | ENGNTLSG | 8 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 791.11da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2193 | 23642310 | NA | NA | GNMPSGG | GNMPSGG | 7 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum 1MR20, | NA | nano-LC-ESI-MS/ MS | NA | 612.36da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2194 | 23642310 | NA | NA | TASSVASTTK | TASSVASTTK | 10 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 952.217 da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2195 | 23642310 | NA | NA | TIKATKT | TIKATKT | 7 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 762.272da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2196 | 23642310 | NA | NA | MLAAKSSAAST | MLAAKSSAAST | 11 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 1037.511da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2197 | 23642310 | NA | NA | VSSGAEIAKI | VSSGAEIAKI | 10 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 973.687da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2198 | 23642310 | NA | NA | NQMLAAKSSAAS | NQMLAAKSSAAS | 12 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 1178.621da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2199 | 23642310 | NA | NA | VINIVLAAV | VINIVLAAV | 9 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 911.725da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2200 | 23642310 | NA | NA | ENGNTLSG | ENGNTLSG | 8 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 791.11da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2201 | 23642310 | NA | NA | GNMPSGG | GNMPSGG | 7 | Echinacea powder suspension + grape must + yeast extract | NA | NA | 30c | 24h | Anti-microbial against B. megaterium F6 as indicator | In vitro | NA | well diffusion assay | Lb. plantarum C2 | NA | nano-LC-ESI-MS/ MS | NA | 612.36da | (MIC )1.4 ± 0.2 mg/ml of peptides. |
| FMDB2202 | NA | rho09 | Purification and identification of an angiotensin I-converting enzyme inhibitory peptide from fermented soybean extract | LVQGS | LVQGS | 5 | Fermented soyabean extract | NA | NA | 30C +45c | 3days +3days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Aspergillus oryzae | NA | MALDI-ToF MS and liquid-phase peptide sequencer | NA | 495.7 Da | 43.7uM |
| FMDB2203 | NA | zhu08 | Identification of ACE-inhibitory peptides in salt-free soy sauce that are transportable across caco-2 cell monolayers | AF | AF | 2 | Salt free soy sauce | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Aspergillus oryzae | NA | NA | NA | NA | 165.3uM |
| FMDB2204 | NA | zhu08 | Identification of ACE-inhibitory peptides in salt-free soy sauce that are transportable across caco-2 cell monolayers | FI | FI | 2 | Salt free soy sauce | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Aspergillus oryzae | NA | NA | NA | NA | NA |
| FMDB2205 | NA | zhu08 | Identification of ACE-inhibitory peptides in salt-free soy sauce that are transportable across caco-2 cell monolayers | IF | IF | 2 | Salt free soy sauce | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Aspergillus oryzae | NA | NA | NA | NA | 65.8 µM |