Welcome to Entry Card of Peptide
Details of FermFooDB_ID FMDB722 |
| Primary information | |
|---|---|
| FMDB_ID | FMDB722 |
| PMID | 22156436 |
| Reference | NA |
| Title | NA |
| Peptide Sequence | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK |
| Length | 53 |
| Food_Matrix | Rye |
| Protein Name | NA |
| pH | 3.40 ± 0.03 to 3.88 ± 0.05. |
| Temperature | 37C |
| Incubation Time | 24h |
| Activity | Antioxidant |
| Experiment | In vitro |
| Model | NA |
| Assay for Activity Measurement | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation |
| Starter Culture | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS64 |
| Hydrolysis | proteinase and peptidase |
| Method of Analysis | nano-LC-ESIMS/ MS |
| M/Z ratio | NA |
| Mass | 5338.5201 |
| IC50 | NA |