Fermented Food Database
This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.
The total number entries retrieved from this search are 991| FMDB_ID | PubMed ID | Reference | Title | Peptide_Sequence | Sequence | Length of peptide | Food_Matrix | Protein | pH | Temperature | Incubation Time | Activity | Experiment | Model | Assay for Activity Measurement | Culture | Hydrolysis | Method of analysis | M_Z ratio | Mass | IC50 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| FMDB1 | 18521593 | NA | NA | DP | DP | 2 | Acetes chinensis (shrimp sp. ) | Marine Protein | 6.12 | 38.10°C | 24.19 h | Ace-inhibitory | NA | NA | NA | Lactobacillus fermentum SM 605 | Proteases | LC-MS | NA | NA | 2.15±0.02 uM |
| FMDB2 | 18521593 | NA | NA | GTG | GTG | 3 | Acetes chinensis (shrimp sp. ) | Marine Protein | 6.12 | 38.10°C | 24.19 h | Ace-inhibitory | NA | NA | NA | Lactobacillus fermentum SM 605 | Proteases | LC-MS | NA | NA | 5.54±0.09uM |
| FMDB3 | 18521593 | NA | NA | ST | ST | 2 | Acetes chinensis (shrimp sp. ) | Marine Protein | 6.12 | 38.10°C | 24.19 h | Ace-inhibitory | NA | NA | NA | Lactobacillus fermentum SM 605 | Proteases | LC-MS | NA | NA | 4.03±0.1uM |
| FMDB4 | 8201050 | NA | NA | AYFYPE | AYFYPE | 6 | Milk | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790 | proteinase | NA | NA | NA | 106uM |
| FMDB5 | 8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | proteases | NA | NA | NA | 4uM |
| FMDB6 | 8201050 | NA | NA | GPFPIIV | GPFPIIV | 7 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | proteases | NA | NA | NA | 4uM |
| FMDB7 | 8201050 | NA | NA | GTQYTDAPSFSDIPNPIGSENSEKTTMPLW | GTQYTDAPSFSDIPNPIGSENSEKTTMPLW | 30 | Milk | αS1-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 346uM |
| FMDB8 | 8201050 | NA | NA | KYPVQPFTESQSLTL | KYPVQPFTESQSLTL | 15 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 93uM |
| FMDB9 | 8201050 | NA | NA | SVLSLSESKVLPVPE | SVLSLSESKVLPVPE | 15 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 39uM |
| FMDB10 | 8201050 | NA | NA | PPQSVLSLSESKVLPVPE | PPQSVLSLSESKVLPVPE | 18 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 25uM |
| FMDB11 | 8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 209uM |
| FMDB12 | 8201050 | NA | NA | YQQPVLGPVRGPFPIIV | YQQPVLGPVRGPFPIIV | 17 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 101uM |
| FMDB13 | 8201050 | NA | NA | LPQNIPPLTQTPVVVPPFLQPEVMGVSK | LPQNIPPLTQTPVVVPPFLQPEVMGVSK | 28 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 144uM |
| FMDB14 | 8201050 | NA | NA | LLYQQPVLGPVRGPFPIIV | LLYQQPVLGPVRGPFPIIV | 19 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 21uM |
| FMDB15 | 8201050 | NA | NA | DELQDKIHPFATQSLVYPFPGPIHNS | DELQDKIHPFATQSLVYPFPGPIHNS | 26 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 4uM |
| FMDB16 | 8201050 | NA | NA | AVPYPQR | AVPYPQR | 7 | Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CP790. | Proteinase | nano-LC-ESIMS/ MS | NA | NA | 15uM |
| FMDB17 | 12369200 | NA | NA | IPP | IPP | 3 | calpis sour Milk | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus and Saccharomyces cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB18 | 12369200 | NA | NA | IPP | IPP | 3 | calpis sour Milk | k-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus and Saccharomyces cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB19 | 12369200 | NA | NA | VPP | VPP | 3 | calpis sour Milk | bovine β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus and Saccharomyces cerevisiae | Proteinase | NA | NA | NA | 9micromol/l |
| FMDB20 | 7673515 | NA | NA | VPP | VPP | 3 | Skim Milk | β-Casein | 4.2 | 37C | 8-10h | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus LBK16H and Saccharomyces cerevisae | proteinase | NA | NA | NA | NA |
| FMDB21 | 7673515 | NA | NA | IPP | IPP | 3 | Skim Milk | β-Casein | 4.2 | 37C | 8-10h | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus LBK16H and Saccharomyces cerevisae | proteinase | NA | NA | NA | NA |
| FMDB22 | 7673515 | NA | NA | IPP | IPP | 3 | Skim Milk | k-Casein | 4.2 | 37C | 8-10h | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus LBK16H and Saccharomyces cerevisae | proteinase | NA | NA | NA | NA |
| FMDB23 | 10416158 | NA | NA | YP | YP | 2 | Yogurt like product | αS1-Casein | 4.3 | NA | NA | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CPN4 | proteinase | NA | NA | NA | 720uM |
| FMDB24 | 10416158 | NA | NA | YP | YP | 2 | Yogurt like product | β-Casein | 4.3 | NA | NA | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CPN4 | proteinase | NA | NA | NA | 720uM |
| FMDB25 | 10416158 | NA | NA | YP | YP | 2 | Yogurt like product | k-Casein | 4.3 | NA | NA | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus helveticus CPN4 | proteinase | NA | NA | NA | 720uM |
| FMDB30 | 17430184 | NA | NA | ARHPHPHLSFM | ARHPHPHLSFM | 11 | Skim Milk | k-Casein | NA | NA | NA | Antioxidant | In vitro | NA | NA | Lactobacillus delbrueckii subsp.bulgaricus IFO13953 | proteinase | NA | NA | NA | NA |
| FMDB31 | 25222748 | NA | NA | DVWY | DVWY | 4 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 582.5 | 0.69±0.04 mM |
| FMDB32 | 25222748 | NA | NA | FDART | FDART | 5 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 609.6 | 1.9±0.1 mM |
| FMDB33 | 25222748 | NA | NA | FQ | FQ | 2 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 294.2 | 7.4±0.6 mM |
| FMDB34 | 25222748 | NA | NA | VAE | VAE | 3 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 318 | 55.9±1.9 mM |
| FMDB35 | 25222748 | NA | NA | VVG | VVG | 3 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 274.2 | 39.6±5.7 mM |
| FMDB36 | 25222748 | NA | NA | WTFR | WTFR | 4 | Buckwheat sprouts | NA | NA | RT | 2wk | Anti-hypertensive | In vitro and In vivo | Spontaneously Hypertensive Rats | NA | Lactobacillus plantarum KT | proteinase | UPLC-MS | NA | 609.5 | 6.7±0.5 mM |
| FMDB64 | 10966406 | NA | NA | LNVPGEIVE | LNVPGEIVE | 9 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 969.5 | 300.1umol/l |
| FMDB65 | 10966406 | NA | NA | NIPPLTQTPV | NIPPLTQTPV | 10 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 1079.6 | 173.3 umol/l |
| FMDB66 | 10966406 | NA | NA | IPPLTQTPV | IPPLTQTPV | 9 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 965.5 | NA |
| FMDB67 | 10966406 | NA | NA | PPLTQTPV | PPLTQTPV | 8 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 852.4 | NA |
| FMDB68 | 10966406 | NA | NA | NVPGEIVE | NVPGEIVE | 8 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 856.4 | NA |
| FMDB69 | 10966406 | NA | NA | NVPGEIVE | NVPGEIVE | 8 | UHT skim Milk | β-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 856.4 | NA |
| FMDB70 | 10966406 | NA | NA | DKIHPF | DKIHPF | 6 | UHT skim Milk | β-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 755.4 | 256.8umol/l |
| FMDB71 | 10966406 | NA | NA | KVLPVPE | KVLPVPE | 7 | UHT skim Milk | β-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 780.1 | NA |
| FMDB72 | 10966406 | NA | NA | VIGSPPEIN | VIGSPPEIN | 9 | UHT skim Milk | k-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 996.5 | >1000umol/l |
| FMDB73 | 10966406 | NA | NA | SPPEIN | SPPEIN | 6 | UHT skim Milk | k-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 655.7 | NA |
| FMDB102 | 24135669 | NA | NA | LVYPFP | LVYPFP | 6 | Skimmed Milk | β-Casein | 5.82 | 37C | 24h | Ace-inhibitory | In vitro | NA | NA | Bifidobacterium. bifidum MF20/5 | proteases | LC-MS | NA | 735.41 | 132uM |
| FMDB103 | 24135669 | NA | NA | VLPVPQK | VLPVPQK | 7 | Skimmed Milk | β-Casein | 5.82 | 37C | 24h | Antioxidant | In vitro | NA | NA | Bifidobacterium. bifidum MF20/5 | proteases | LC-MS | NA | NA | NA |
| FMDB104 | 24135669 | NA | NA | LPLP | LPLP | 4 | Skimmed Milk | β-Casein | 5.82 | 37C | 24h | NA | NA | NA | Spectrophotometric assay using HHL | Bifidobacterium. bifidum MF20/5 | proteases | LC-MS | NA | NA | 750uM |
| FMDB107 | 26996626 | NA | NA | PKHKLMPF | PKHKLMPF | 8 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 997.9 | NA | NA |
| FMDB108 | 26996626 | NA | NA | PKHKLMPF | PKHKLMPF | 8 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 997.9 | NA | NA |
| FMDB109 | 26996626 | NA | NA | PKHKLMPF | PKHKLMPF | 8 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 997.9 | NA | NA |
| FMDB110 | 26996626 | NA | NA | PKHKLMPF | PKHKLMPF | 8 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 997.9 | NA | NA |
| FMDB111 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB112 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB113 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB114 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB115 | 26996626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1151.8 | NA | NA |
| FMDB116 | 26996626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1151.8 | NA | NA |
| FMDB117 | 26996626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1151.8 | NA | NA |
| FMDB118 | 26996626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1151.8 | NA | NA |
| FMDB119 | 26996626 | NA | NA | LGPVRGPFPIIV | LGPVRGPFPIIV | 12 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1265.1 | NA | NA |
| FMDB120 | 26996626 | NA | NA | LGPVRGPFPIIV | LGPVRGPFPIIV | 12 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1265.1 | NA | NA |
| FMDB121 | 26996626 | NA | NA | LGPVRGPFPIIV | LGPVRGPFPIIV | 12 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1265.1 | NA | NA |
| FMDB122 | 26996626 | NA | NA | LGPVRGPFPIIV | LGPVRGPFPIIV | 12 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1265.1 | NA | NA |
| FMDB123 | 26996626 | NA | NA | MHQPHQPLPPT | MHQPHQPLPPT | 11 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1283.1 | NA | NA |
| FMDB124 | 26996626 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1363.6 | NA | NA |
| FMDB125 | 26996626 | NA | NA | WMHQPHQPLPPT | WMHQPHQPLPPT | 12 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1469.3 | NA | NA |
| FMDB126 | 26996626 | NA | NA | WMHQPHQPLPPT | WMHQPHQPLPPT | 12 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1469.3 | NA | NA |
| FMDB127 | 26996626 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Milk | αS1-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1665.5 | NA | NA |
| FMDB128 | 26996626 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1665.5 | NA | NA |
| FMDB129 | 26996626 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1665.5 | NA | NA |
| FMDB130 | 26996626 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1665.5 | NA | NA |
| FMDB131 | 26996626 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1881.3 | NA | NA |
| FMDB132 | 26996626 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1881.3 | NA | NA |
| FMDB133 | 26996626 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1881.3 | NA | NA |
| FMDB134 | 26996626 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1881.3 | NA | NA |
| FMDB135 | 26996626; 20397193 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | Immunomodulatory | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1994.3 | NA | NA |
| FMDB136 | 26996626; 20397193 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | Immunomodulatory | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1994.3 | NA | NA |
| FMDB137 | 26996626; 20397193 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | Immunomodulatory | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1994.3 | NA | NA |
| FMDB138 | 26996626; 20397193 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | Immunomodulatory | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1994.3 | NA | NA |
| FMDB139 | 26996626 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2107.4 | NA | NA |
| FMDB140 | 26996626 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2107.4 | NA | NA |
| FMDB141 | 26996626 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2107.4 | NA | NA |
| FMDB142 | 26996626 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2107.4 | NA | NA |
| FMDB143 | 26996626 ; 16899668 | NA | NA | RPKHPIKHQGLPQEVLNEN | RPKHPIKHQGLPQEVLNEN | 19 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2235 | NA | NA |
| FMDB144 | 26996626 ; 16899668 | NA | NA | RPKHPIKHQGLPQEVLNEN | RPKHPIKHQGLPQEVLNEN | 19 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2235 | NA | NA |
| FMDB145 | 26996626 ; 16899668 | NA | NA | RPKHPIKHQGLPQEVLNEN | RPKHPIKHQGLPQEVLNEN | 19 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2235 | NA | NA |
| FMDB146 | 26996626 | NA | NA | FLLYQEPVLGPVRGPFPIIV | FLLYQEPVLGPVRGPFPIIV | 20 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2254.3 | NA | NA |
| FMDB147 | 26996626 | NA | NA | MKPWIQPKTKVIPYVRYL | MKPWIQPKTKVIPYVRYL | 18 | Milk | αS2-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2260.37 | NA | NA |
| FMDB148 | 26996626 ; 16899668 | NA | NA | RPKHPIKHQGLPQEVLNENL | RPKHPIKHQGLPQEVLNENL | 20 | Milk | αS1-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2348.3 | NA | NA |
| FMDB149 | 26996626 | NA | NA | RPKHPIKHQGLPQEVLNENL | RPKHPIKHQGLPQEVLNENL | 20 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2348.3 | NA | NA |
| FMDB150 | 26996626 | NA | NA | RPKHPIKHQGLPQEVLNENL | RPKHPIKHQGLPQEVLNENL | 20 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2348.3 | NA | NA |
| FMDB151 | 26996626 | NA | NA | RPKHPIKHQGLPQEVLNENL | RPKHPIKHQGLPQEVLNENL | 20 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2348.3 | NA | NA |
| FMDB152 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMP | LSQSKVLPVPQKAVPYPQRDMP | 22 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2479.2 | NA | NA |
| FMDB153 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMP | LSQSKVLPVPQKAVPYPQRDMP | 22 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2479.2 | NA | NA |
| FMDB154 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMP | LSQSKVLPVPQKAVPYPQRDMP | 22 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2479.2 | NA | NA |
| FMDB155 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMP | LSQSKVLPVPQKAVPYPQRDMP | 22 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2479.2 | NA | NA |
| FMDB156 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 3.83 ± 0.2 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB157 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB158 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB159 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB160 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQA | LSQSKVLPVPQKAVPYPQRDMPIQA | 25 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2790.8 | NA | NA |
| FMDB161 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAF | LSQSKVLPVPQKAVPYPQRDMPIQAF | 26 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2938.6 | NA | NA |
| FMDB162 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAF | LSQSKVLPVPQKAVPYPQRDMPIQAF | 26 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2938.6 | NA | NA |
| FMDB163 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAF | LSQSKVLPVPQKAVPYPQRDMPIQAF | 26 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2938.6 | NA | NA |
| FMDB164 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAF | LSQSKVLPVPQKAVPYPQRDMPIQAF | 26 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2938.6 | NA | NA |
| FMDB165 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAFL | LSQSKVLPVPQKAVPYPQRDMPIQAFL | 27 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3051.3 | NA | NA |
| FMDB166 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAFL | LSQSKVLPVPQKAVPYPQRDMPIQAFL | 27 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3051.3 | NA | NA |
| FMDB167 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAFL | LSQSKVLPVPQKAVPYPQRDMPIQAFL | 27 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3051.3 | NA | NA |
| FMDB168 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAFL | LSQSKVLPVPQKAVPYPQRDMPIQAFL | 27 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3051.3 | NA | NA |
| FMDB169 | 26996626; 10434050 | NA | NA | VYQHQKAMKPWIQPKTKVIPYVRYL | VYQHQKAMKPWIQPKTKVIPYVRYL | 25 | Milk | αS2-Casein | 3.83 ± 0.2 | 41c | 48h | Antibacterial | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3115.4 | NA | NA |
| FMDB170 | 26996626; 10434050 | NA | NA | VYQHQKAMKPWIQPKTKVIPYVRYL | VYQHQKAMKPWIQPKTKVIPYVRYL | 25 | Milk | αS2-Casein | 4.27 ± 0.15 | 41c | 48h | Antibacterial | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3115.4 | NA | NA |
| FMDB171 | 26996626; 10434050 | NA | NA | VYQHQKAMKPWIQPKTKVIPYVRYL | VYQHQKAMKPWIQPKTKVIPYVRYL | 25 | Milk | αS2-Casein | 4.32 ± 0.6 | 41c | 48h | Antibacterial | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3115.4 | NA | NA |
| FMDB172 | 26996626; 10434050 | NA | NA | VYQHQKAMKPWIQPKTKVIPYVRYL | VYQHQKAMKPWIQPKTKVIPYVRYL | 25 | Milk | αS2-Casein | 4.39± 0.22 | 41c | 48h | Antibacterial | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3115.4 | NA | NA |
| FMDB178 | NA | pan05 | Antihypertensive peptides from skimmed Milk hydrolysate digested by cell-free extract of Lactobacillus helveticus JCM1004 | VPP | VPP | 3 | Skimmed Milk | β-Casein &k Casein | 6.5-7.0 | 37c | 20h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substarte | Lactobacillus helveticus JCM1004 | proteinase and peptidase | RPHPLC and protein sequencer | NA | NA | 9.13 ± 0.21 uM |
| FMDB179 | NA | pan05 | NA | IPP | IPP | 3 | Skimmed Milk | β-Casein &k Casein | 6.5-7.0 | 37c | 20h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substarte | Lactobacillus helveticus JCM1004 | proteinase and peptidase | RPHPLC and protein sequencer | NA | NA | 5.15 ± 0.17 UM |
| FMDB180 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | LVYSHTEPIP | LVYSHTEPIP | 10 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | NA | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB181 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | EPIPY | EPIPY | 5 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Immunostimulatory | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB182 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | LPP | LPP | 3 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB183 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | VMVPFLQP | VMVPFLQP | 8 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | NA | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB184 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | PAVMVPFLQP | PAVMVPFLQP | 10 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | NA | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB185 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | PKRKEMPLLQSPVVPFTESQ | PKRKEMPLLQSPVVPFTESQ | 20 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Intestinal protection | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB186 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | KRKEMPLLQSPV | KRKEMPLLQSPV | 12 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Cytomodulatory | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB187 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | SPVVPFTE | SPVVPFTE | 8 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB188 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | LHLPLPL | LHLPLPL | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB189 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | KVLPVPQ | KVLPVPQ | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive;Antioxidant | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | 19mg/ml |
| FMDB190 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | VPYPQR | VPYPQR | 6 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Antioxidant;Anti-hypertensive | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB191 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | MPVQAVLPFQEPVPDPVR | MPVQAVLPFQEPVPDPVR | 18 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-inflammatory | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB192 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | QEPVPDPVRGLHP | QEPVPDPVRGLHP | 13 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Immunomodulatory | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB193 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | VPDPVRGLHP | VPDPVRGLHP | 10 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Anti-hypertensive | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB194 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | PVRGLHP | PVRGLHP | 7 | Camel skimmed Milk | β-Casein | 4.6 | 42c | 7h | Antioxidant | In vitro | NA | ABTS radical scavenging Trolox equivalent antioxidant capacity (TEAC) method | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | 19mg/ml |
| FMDB195 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | LKDTRNE | LKDTRNE | 7 | Camel skimmed Milk | αS1-Casein | 4.6 | 42c | 7h | Red blood cell binding | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB196 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | LKDTRNEPTEDH | LKDTRNEPTEDH | 12 | Camel skimmed Milk | αS1-Casein | 4.6 | 42c | 7h | NA | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB197 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | YFPIQFVQSR | YFPIQFVQSR | 10 | Camel skimmed Milk | k-Casein | 4.6 | 42c | 7h | Casoxin C (Opioid antagonist) | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB198 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | YPSYGIN | YPSYGIN | 7 | Camel skimmed Milk | k-Casein | 4.6 | 42c | 7h | CasoxinA (Opioid antagonist) | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB199 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | KISQFYQK | KISQFYQK | 8 | Camel skimmed Milk | αS2-Casein | 4.6 | 42c | 7h | calmodulin Anatgonist | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB200 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | GQIV MNPWDQ | GQIV MNPWDQ | 11 | Camel skimmed Milk | αS2-Casein | 4.6 | 42c | 7h | Food allergy prevention | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB201 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | PGLYRP1 | PGLYRP1 | 7 | NA | NA | 4.6 | 42c | 7h | Angiogenisis | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB202 | NA | hatmi16 | Identification of bioactive peptides derived from Caseins,glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), and peptidoglycan recognition protein-1 (PGRP-1) in fermented camel Milk | HRDVQPTL | HRDVQPTL | 8 | Camel skimmed Milk | PGRP-1 | 4.6 | 42c | 7h | Antitumoral | NA | NA | NA | S. thermophilus LMD-9 (ATCC BAA-491®) | Protease | HPLC/nESI-MS/MS | NA | NA | NA |
| FMDB204 | NA | pan10 | Optimization of sour Milk fermentation for the production of ACE-inhibitory peptides and purification of a novel peptide from Whey protein hydrolysate | RLSFNP | RLSFNP | 6 | Whey protein | Bovine Beta lactoglobulin | 7.5 | 39C | 20h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lb. helveticus LB10 | proteinase and peptidase | RPHLC &triple-quadruple mas spectrometer ESI-MS/MS | NA | 732.84Da | 177.39 μm. |
| FMDB205 | 22103626; 17430184 | NA | NA | VKEAMAPK | VKEAMAPK | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Antioxidant | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB206 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB207 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB208 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB209 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB210 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB211 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB212 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB213 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB214 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB215 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB216 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB217 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB218 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB219 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB220 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB221 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB222 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB223 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB224 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB225 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB226 | 22103626;11170591 | NA | NA | KVLPVPQK | KVLPVPQK | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | LOX inhibitor | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB227 | 22103626;11170591 | NA | NA | KVLPVPQK | KVLPVPQK | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | LOX inhibitor | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB228 | 22103626;11170591 | NA | NA | KVLPVPQK | KVLPVPQK | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | LOX inhibitor | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB229 | 22103626;11170591 | NA | NA | KVLPVPQK | KVLPVPQK | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | LOX inhibitor | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB230 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB231 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB232 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB233 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB234 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB235 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB236 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB237 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB238 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB239 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB240 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB241 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB242 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB243 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB244 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB245 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB246 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB247 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB248 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB249 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB250 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB251 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB252 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB253 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB254 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB255 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB256 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB257 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB258 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB259 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB260 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB261 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB262 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB263 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB264 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB265 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB266 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB267 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB268 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB269 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB270 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB271 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB272 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB273 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB274 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB275 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB276 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB277 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB278 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB279 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB280 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB281 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB282 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB283 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB284 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB285 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB286 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB287 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB288 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB289 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB290 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB291 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB292 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB293 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB294 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB295 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB296 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB297 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB298 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB299 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB300 | 22103626;16448175 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB301 | 22103626;16448175 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB302 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB303 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB304 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB305 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB306 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB307 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB308 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB309 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB310 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB311 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB312 | 22103626;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB313 | 22103626;8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB314 | 22103626;8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB315 | 22103626;8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB316 | 22103626;8880454 | NA | NA | MKPWIQPK | MKPWIQPK | 8 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB317 | 22103626;8880454 | NA | NA | MKPWIQPK | MKPWIQPK | 8 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB318 | 22103626;8880454 | NA | NA | MKPWIQPK | MKPWIQPK | 8 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB319 | 22103626;8880454 | NA | NA | TKVIP | TKVIP | 5 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB320 | 22103626;8880454 | NA | NA | TKVIP | TKVIP | 5 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB321 | 22103626;8880454 | NA | NA | TKVIP | TKVIP | 5 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB322 | 22103626 | NA | NA | PYVRYL | PYVRYL | 6 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory;Antioxidant | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB323 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB324 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB325 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB326 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB327 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB328 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB329 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB330 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB331 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB332 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB333 | 22103626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB334 | 22103626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB335 | 22103626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB336 | 22103626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB337 | 16476172 | NA | NA | WLAHK | WLAHK | 5 | goat Whey | Alpha lactoglobulin | NA | NA | NA | Ace-inhibitory | In vitro | NA | NA | Can parapsilosis and Lb paracasei | protease | NA | NA | NA | NA |
| FMDB338 | 21787916 | NA | NA | YQEPVLGPVRGPFPI | YQEPVLGPVRGPFPI | 15 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 835.0 (+2) | 1668.04 | 5.3 ± 0.10ug/ml |
| FMDB339 | 21787916 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 941.4 (+2) | 1880.28 | 5.3 ± 0.10ug/ml |
| FMDB340 | 21787916 | NA | NA | EVLNENLLRF | EVLNENLLRF | 10 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 624 (+2) | 1236.82 | 5.3 ± 0.10ug/ml |
| FMDB341 | 21787916 | NA | NA | FVAPFPEVFGK | FVAPFPEVFGK | 11 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 619.4 (+2) | 1245.86 | 5.3 ± 0.10ug/ml |
| FMDB342 | 21787916 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 941.4 (+2) | 1880.28 | 10.4 ± 0.40 ug/ml |
| FMDB343 | 21787916 | NA | NA | RPKHPIKHQGLPQEV | RPKHPIKHQGLPQEV | 15 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 945.2 (+2) | 1893.38 | 10.4 ± 0.40 ug/ml |
| FMDB344 | 21787916 | NA | NA | RPKHPIKHQGLPQEVLNENLLR | RPKHPIKHQGLPQEVLNENLLR | 22 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 922.3 (+2) | 2763.87 | 10.4 ± 0.40 ug/ml |
| FMDB345 | 21787916 | NA | NA | FVAPFPEVFGK | FVAPFPEVFGK | 11 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 619.5 (+2) | 1236.9 | 10.4 ± 0.40 ug/ml |
| FMDB346 | 21787916 | NA | NA | EVLNENLLRF | EVLNENLLRF | 10 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 624.2 (+2) | 1246.22 | 10.4 ± 0.40 ug/ml |
| FMDB347 | 21787916 | NA | NA | YQEPVLGPVRGPF | YQEPVLGPVRGPF | 13 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 729.9 (+2) | 1457.8 | 10.4 ± 0.40 ug/ml |
| FMDB348 | 21787916 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 941.7 (+2) | 1881.46 | 10.4 ± 0.40 ug/ml |
| FMDB349 | 22901481 | NA | NA | DDQNPH | DDQNPH | 6 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 362.9 (+2) | 723.9 | 0.076 ±004ug/ml |
| FMDB350 | 22901481 | NA | NA | LDDDLTDDI | LDDDLTDDI | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 517.4(+2) | 1032.8 | 0.076 ±004ug/ml |
| FMDB351 | 22901481 | NA | NA | YPSYGL | YPSYGL | 6 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 350.3(+2) | 698.6 | 0.076 ±004ug/ml |
| FMDB352 | 22901481 | NA | NA | HPHPHLSFMAIPP | HPHPHLSFMAIPP | 13 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 740.5(+2) | 1479 | 0.076 ±004ug/ml |
| FMDB353 | 22901481 | NA | NA | YDTQAIVQ | YDTQAIVQ | 8 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 518.8(+2) | 1035.7 | 0.076 ±004ug/ml |
| FMDB354 | 22901481 | NA | NA | DDDLTDDIMCV | DDDLTDDIMCV | 11 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 462.3(+3) | 1386.8 | 0.076 ±004ug/ml |
| FMDB355 | 22901481 | NA | NA | YPSYG | YPSYG | 5 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 586.7(+1) | 585.9 | 0.076 ±004ug/ml |
| FMDB356 | 22901481 | NA | NA | AESIS | AESIS | 5 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | αS1-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 506.9(+3) | 505.9 | NA |
| FMDB357 | 22901481 | NA | NA | SITRINK | SITRINK | 7 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 416.1(+2) | 830.1 | NA |
| FMDB358 | 22901481 | NA | NA | HIQKEDVPS | HIQKEDVPS | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | αS1-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 526.7(+2) | 1051.4 | NA |
| FMDB359 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 453(+2) | 904.1 | NA |
| FMDB360 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 453.2(+2) | 904.3 | NA |
| FMDB361 | 22901481 | NA | NA | NAVPITPTLN | NAVPITPTLN | 10 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | αS2-CN | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 520.2(+2) | 1038.4 | NA |
| FMDB362 | 22901481 | NA | NA | SLPQNIPPL | SLPQNIPPL | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 489.6(+2) | 977.1 | NA |
| FMDB363 | 22901481 | NA | NA | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 859.4(+2) | 1716.9 | NA |
| FMDB364 | 22901481 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 576.2(+2) | 1150.4 | NA |
| FMDB365 | 22901481 | NA | NA | SLPQNIPPL | SLPQNIPPL | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 489.7(+2) | 977.2 | NA |
| FMDB366 | 22901481 | NA | NA | YIPIQYVLS | YIPIQYVLS | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 548.2(+2) | 1094.4 | NA |
| FMDB367 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 453.5(+2) | 904.4 | 0.034 ± 0.002 μg/mL |
| FMDB368 | 22901481 | NA | NA | PEINTVQVTSTAV | PEINTVQVTSTAV | 13 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 453.2(+3) | 1356.7 | 0.034 ± 0.002 μg/mL |
| FMDB369 | 22901481 | NA | NA | GYLAVA | GYLAVA | 6 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | Serotransferrin | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 198.3(+3) | 591.8 | 0.034 ± 0.002 μg/mL |
| FMDB370 | 22901481 | NA | NA | DVENLHLPLPLL | DVENLHLPLPLL | 12 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 686.6(+2) | 1371.53 | 0.041 ± 0.003 ug/ml |
| FMDB371 | 22901481 | NA | NA | YPSYGL | YPSYGL | 6 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 350.2(+2) | 698.6 | 0.041 ± 0.003 ug/ml |
| FMDB372 | 22901481 | NA | NA | ENGEC | ENGEC | 5 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-lactoglobulin | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 550.9(+3) | 549.8 | 0.041 ± 0.003 ug/ml |
| FMDB373 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 453.1(+2) | 904.2 | 0.084 ± 0.003 μg/mL |
| FMDB374 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 453.1(+2) | 904.2 | NA |
| FMDB375 | 22901481 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 576.3(+2) | 1150.5 | NA |
| FMDB376 | 22901481 | NA | NA | TDDIMCVK | TDDIMCVK | 8 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 922.4(+1) | 922.4 | NA |
| FMDB377 | 24135669 | NA | NA | LVYPFP | LVYPFP | 6 | probiotic femented Milk | β-Casein | 6.67 | 37C | 24h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Bifidobacterium bifidum MF 20/5 | proteinase and peptidase | LCMS | NA | NA | 132uM |
| FMDB378 | 24135669 | NA | NA | LPLP | LPLP | 4 | probiotic femented Milk | β-Casein | 6.67 | 37C | 24h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Bifidobacterium bifidum MF 20/5 | proteinase and peptidase | LCMS | NA | NA | 750uM |
| FMDB379 | 24135669;11170591 | NA | NA | VLPVPQK | VLPVPQK | 7 | probiotic femented Milk | β-Casein | 6.67 | 37C | 24h | Ace-inhibitory;Antioxidant | In vitro | NA | spectrophotometeric assay using HHL as substrate | Bifidobacterium bifidum MF 20/5 | proteinase and peptidase | LCMS | NA | NA | NA |
| FMDB380 | 24135669 | NA | NA | IPP | IPP | 3 | NA | NA | 4.6 | 37C | 24h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | L. helveticus DSM13137 | proteinase and peptidase | LCMS | NA | NA | NA |
| FMDB381 | 24135669 | NA | NA | VPP | VPP | 3 | NA | NA | 4.6 | 37C | 24h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | L. helveticus DSM13137 | proteinase and peptidase | LCMS | NA | NA | NA |
| FMDB705 | 22156436 | NA | NA | MAPAAVAAAEAGSK | MAPAAVAAAEAGSK | 14 | Whole wheat flour | NA | 3.40 ± 0.03 | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1243.623 | NA |
| FMDB706 | 22156436 | NA | NA | DNIPIVIR | DNIPIVIR | 8 | Whole wheat flour | NA | 3.40 ± 0.03 | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS48 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 938.5549 | NA |
| FMDB707 | 22156436 | NA | NA | AIAGAGVLSGYDQLQILFFGK | AIAGAGVLSGYDQLQILFFGK | 21 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS49 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2167.1677 | NA |
| FMDB708 | 22156436 | NA | NA | GNQEKVLELVQR | GNQEKVLELVQR | 12 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS50 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1411.7783 | NA |
| FMDB709 | 22156436 | NA | NA | PAGSAAGAAP | PAGSAAGAAP | 10 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS51 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 769.8311 | NA |
| FMDB710 | 22156436 | NA | NA | EALEAMFL | EALEAMFL | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS52 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 924.1021 | NA |
| FMDB711 | 22156436 | NA | NA | AAGAAAAARSAGQCGR | AAGAAAAARSAGQCGR | 16 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS53 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1387.6738 | NA |
| FMDB712 | 22156436 | NA | NA | ITFAAYRR | ITFAAYRR | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS54 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 998.1621 | NA |
| FMDB713 | 22156436 | NA | NA | HPVPPKKK | HPVPPKKK | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS55 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 912.2177 | NA |
| FMDB714 | 22156436 | NA | NA | VFVDEGLEVLGWRPVPFNVSVVGRNAK | VFVDEGLEVLGWRPVPFNVSVVGRNAK | 27 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS56 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2982.608 | NA |
| FMDB715 | 22156436 | NA | NA | RLSLPAGAPVTVAVSP | RLSLPAGAPVTVAVSP | 16 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS57 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1535.8101 | NA |
| FMDB716 | 22156436 | NA | NA | NANGELCPNNMCCSQWGYCGLGSEFCGNGCQSGACCPEK | NANGELCPNNMCCSQWGYCGLGSEFCGNGCQSGACCPEK | 39 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS58 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 4033.4843 | NA |
| FMDB717 | 22156436 | NA | NA | LCPVHRAADL | LCPVHRAADL | 10 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS59 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1095.3231 | NA |
| FMDB718 | 22156436 | NA | NA | PAEMVAAALDR | PAEMVAAALDR | 11 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS60 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1484.7511 | NA |
| FMDB719 | 22156436 | NA | NA | KVALMSAGSMH | KVALMSAGSMH | 11 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS61 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1131.2679 | NA |
| FMDB720 | 22156436 | NA | NA | DLADIPQQQRLMAGLALVVATVIFLK | DLADIPQQQRLMAGLALVVATVIFLK | 26 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS62 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2822.6092 | NA |
| FMDB721 | 22156436 | NA | NA | KNGSIFNSPSATAATIIHGHNYSGLAYLDFVTSK | KNGSIFNSPSATAATIIHGHNYSGLAYLDFVTSK | 34 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS63 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 3580.795 | NA |
| FMDB722 | 22156436 | NA | NA | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK | 53 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS64 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 5338.5201 | NA |
| FMDB723 | 22156436 | NA | NA | YEWEPTVPNFDVAKDVTDM | YEWEPTVPNFDVAKDVTDM | 19 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS65 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2255.0093 | NA |
| FMDB724 | 22156436 | NA | NA | GVSNAAVVAGGH | GVSNAAVVAGGH | 12 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS66 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1037.5254 | NA |
| FMDB725 | 22156436 | NA | NA | DAQEFKR | DAQEFKR | 7 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS67 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 892.4403 | NA |
| FMDB726 | 22156436 | NA | NA | PPGPGPGPPPPPGAAGRGGGG | PPGPGPGPPPPPGAAGRGGGG | 21 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS68 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1704.8721 | NA |
| FMDB727 | 22156436 | NA | NA | HKEMQAIFDVYIMFIN | HKEMQAIFDVYIMFIN | 16 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS69 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2000.3734 | NA |
| FMDB728 | 22156436 | NA | NA | TGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR | TGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR | 57 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS70 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 5124.5196 | NA |
| FMDB729 | 22156436 | NA | NA | DTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR | DTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR | 52 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS71 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 4921.2889 | NA |
| FMDB730 | NA | padghan16 | Production of Angiotensin-I-Converting-Enzyme-Inhibitory Peptides in Fermented Milks (Lassi) Fermented by Lactobacillus acidophillus with Consideration of Incubation Period and Simmering Treatment | LPYPYYAKPA | LPYPYYAKPA | 10 | fermented Milk ( lassi) | k-Casein | 4.6 | 37C | 10h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1181.66 | NA |
| FMDB731 | NA | NA | YPYYAKPA | YPYYAKPA | 8 | fermented Milk ( lassi) | k-Casein | 4.6 | 37C | 10h | Antagonistic | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 971.61 | NA | |
| FMDB732 | NA | NA | AVRSPAQIL | AVRSPAQIL | 9 | fermented Milk ( lassi) | k-Casein | 4.6 | 37C | 10h | NA | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 953.62 | NA | |
| FMDB733 | NA | NA | LPNTVPAK | LPNTVPAK | 8 | fermented Milk ( lassi) | k-Casein | 4.6 | 37C | 10h | NA | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 838.52 | NA | |
| FMDB734 | NA | NA | RPKQPIKHQGLPQ | RPKQPIKHQGLPQ | 13 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | Immunomodulatory;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1525.91 | NA | |
| FMDB735 | NA | NA | RPKQPIKHQGLPQGVL | RPKQPIKHQGLPQGVL | 16 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | Immunomodulatory;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1795.1 | NA | |
| FMDB736 | NA | NA | RPKQPIKHQGLPQG | RPKQPIKHQGLPQG | 14 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | Immunomodulatory;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1582.99 | NA | |
| FMDB737 | NA | NA | APFPEVFGK | APFPEVFGK | 9 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | NA | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 990.56 | NA | |
| FMDB738 | NA | NA | APFPEVFGKE | APFPEVFGKE | 10 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | NA | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1119.62 | NA | |
| FMDB739 | NA | NA | APFPEVFGKEKVNEL | APFPEVFGKEKVNEL | 15 | fermented Milk ( lassi) | αS1-Casein | 4.6 | 37C | 10h | Antioxidant | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1702.98 | NA | |
| FMDB740 | NA | NA | AQTQSLVYPFPGPIPK | AQTQSLVYPFPGPIPK | 16 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Opioid;Immunomodulatory;Cytomodulatory | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1742.01 | NA | |
| FMDB741 | NA | NA | DELQDKIHP | DELQDKIHP | 9 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1093.64 | NA | |
| FMDB742 | NA | NA | DELQDKIHPF | DELQDKIHPF | 10 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1240.71 | NA | |
| FMDB743 | NA | NA | DELQDKIHPFAQTQ | DELQDKIHPFAQTQ | 14 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1668.86 | NA | |
| FMDB744 | NA | NA | EPVLGPVRGPFP | EPVLGPVRGPFP | 12 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Immunomodulatory;Antioxidant;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1263.69 | NA | |
| FMDB745 | NA | NA | EPVLGPVRGPFPI | EPVLGPVRGPFPI | 13 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Immunomodulatory;Antioxidant;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1376.94 | NA | |
| FMDB746 | NA | NA | EPVLGPVRGPFPIIV | EPVLGPVRGPFPIIV | 15 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1589.94 | NA | |
| FMDB747 | NA | NA | GVSKVKEAMAPKH | GVSKVKEAMAPKH | 13 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Antioxidant | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1380.84 | NA | |
| FMDB748 | NA | NA | IPPLTQTPVVVPPFLQPE | IPPLTQTPVVVPPFLQPE | 18 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1971.34 | NA | |
| FMDB749 | NA | NA | KVLPVPQK | KVLPVPQK | 8 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Antioxidant;Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 907.63 | NA | |
| FMDB750 | NA | NA | LHLPLPLLQSW | LHLPLPLLQSW | 11 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1315.92 | NA | |
| FMDB751 | NA | NA | LPLPLLQSW | LPLPLLQSW | 9 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1064.63 | NA | |
| FMDB752 | NA | NA | LPLPLLQSWM | LPLPLLQSWM | 10 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1196.86 | NA | |
| FMDB753 | NA | NA | LVYPFPGPIPK | LVYPFPGPIPK | 11 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Opioid | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1227.69 | NA | |
| FMDB754 | NA | NA | LVYPFPGPIPKSLPQ | LVYPFPGPIPKSLPQ | 15 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Opioid | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1652.02 | NA | |
| FMDB755 | NA | NA | LVYPFPGPIPKSLPQN | LVYPFPGPIPKSLPQN | 16 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Opioid | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1767.03 | NA | |
| FMDB756 | NA | NA | MAPKHKEMPFPKYPVEPF | MAPKHKEMPFPKYPVEPF | 18 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory;Cytomodulatory | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 2172.25 | NA | |
| FMDB757 | NA | NA | MPFPKYPVEPF | MPFPKYPVEPF | 11 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1350.78 | NA | |
| FMDB758 | NA | NA | NLHLPLPLLQSW | NLHLPLPLLQSW | 12 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1430.03 | NA | |
| FMDB759 | NA | NA | PPLTQTPVVVP | PPLTQTPVVVP | 11 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1146.12 | NA | |
| FMDB760 | NA | NA | PPVVVPPFLQPEIM | PPVVVPPFLQPEIM | 14 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1565.96 | NA | |
| FMDB761 | NA | NA | QDKIHPFAQTQ | QDKIHPFAQTQ | 11 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1311.66 | NA | |
| FMDB762 | NA | NA | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory;Antioxidant;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1717.07 | NA | |
| FMDB763 | NA | NA | SKVLPVPQKAVPYPQ | SKVLPVPQKAVPYPQ | 15 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Antioxidant;Anti-microbial | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1651.04 | NA | |
| FMDB764 | NA | NA | SLPQNIPPLTQTPVVVPPFLQPE | SLPQNIPPLTQTPVVVPPFLQPE | 23 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 2510.36 | NA | |
| FMDB765 | NA | NA | SLPQNIPPLTQTPVVVPPFLQPEIM | SLPQNIPPLTQTPVVVPPFLQPEIM | 25 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | NA | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 2754.7 | NA | |
| FMDB766 | NA | NA | SLVYPFPGPIPKSLPQ | SLVYPFPGPIPKSLPQ | 16 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Opioid;Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1739.02 | NA | |
| FMDB767 | NA | NA | SWMHQPPQPLPPTVMFPPQSVLSL | SWMHQPPQPLPPTVMFPPQSVLSL | 24 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 2713.48 | NA | |
| FMDB768 | NA | NA | TPVVVPPFLQPEIM | TPVVVPPFLQPEIM | 14 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Anti-hypertensive | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1565.96 | NA | |
| FMDB769 | NA | NA | VPPFL | VPPFL | 5 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | NA | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 571.32 | NA | |
| FMDB770 | NA | NA | WMHQPPQPLPPTVMFPPQSVLSL | WMHQPPQPLPPTVMFPPQSVLSL | 23 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 2626.67 | NA | |
| FMDB771 | NA | NA | YPFPGPIPK | YPFPGPIPK | 9 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Opioid | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1014.62 | NA | |
| FMDB772 | NA | NA | YPFPGPIPKSLPQ | YPFPGPIPKSLPQ | 13 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | NA | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1439.8 | NA | |
| FMDB773 | NA | NA | YPFPGPIPKSLPQN | YPFPGPIPKSLPQN | 14 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | NA | NA | NA | NA | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1553.95 | NA | |
| FMDB774 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | fermented Milk ( lassi) | β-Casein | 4.6 | 37C | 10h | Ace-inhibitory;Antioxidant;Immunomodulatory;Anti-microbial | In vitro | NA | spectrophotometric assay using HHL as substrate | L.acidophilus NCDC-15,Lactococcus lactis NCDC-167 and S. thermophilus | Cell envelope protease | nano HPLCTRAPMS | NA | 1880.2 | NA | |
| FMDB776 | 11410002 | NA | NA | IPRPRPRP | IPRPRPRP | 8 | soy protein+glucose | Glycinin | NA | 30C | 48h | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | ACE In hibitory activity using FAPGG as the substrate | Bacillus sp. | proteinase | MALDI-TOF/TOF MS | NA | NA | 0.0072 +/- 0.0017mM |
| FMDB777 | 11410003 | NA | NA | PIPFP | PIPFP | 5 | soy protein+glucose | Glycinin | NA | 30C | 48h | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | ACE In hibitory activity using FAPGG as the substrate | Bacillus sp. | proteinase | MALDI-TOF/TOF MS | NA | NA | 0.0660 +/- 0.0153mM |
| FMDB778 | 11410004 | NA | NA | PVNKP | PVNKP | 5 | soy protein+glucose | Glycinin | NA | 30C | 48h | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | ACE In hibitory activity using FAPGG as the substrate | Bacillus sp. | proteinase | MALDI-TOF/TOF MS | NA | NA | 0.0461 +/- 0.0052mM |
| FMDB779 | 11410005 | NA | NA | LKPDNR | LKPDNR | 6 | soy protein+glucose | Glycinin g2 | NA | 30C | 48h | Ace-inhibitory | In vivo | Spontaneously Hypertensive Rats | ACE In hibitory activity using FAPGG as the substrate | Bacillus sp. | proteinase | MALDI-TOF/TOF MS | NA | NA | 0.1208 +/- 0.0017mM |
| FMDB780 | NA | papdimitriou07 | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | DKIHPFAQ | DKIHPFAQ | 8 | sheep Milk Yogurt | β-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | 257uM |
| FMDB781 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | TQTPVVVP | TQTPVVVP | 8 | sheep Milk Yogurt | β-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | 173uM | |
| FMDB782 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | KAVPQ | KAVPQ | 5 | fermented sheep Milk | β-Casein | NA | 37C | 18h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | 39uM | |
| FMDB783 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | RPKHPIKH YQKA | RPKHPIKH YQKA | 13 | fermented sheep Milk | αS1-Casein | NA | 37C | 18h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus Y10.13 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB784 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | RPKHPIKH | RPKHPIKH | 8 | sheep Milk Yogurt | αS1-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | 40.3uM | |
| FMDB785 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | SQPK YQEP | SQPK YQEP | 9 | sheep Milk Yogurt | β-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB786 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | NQFLPYPY | NQFLPYPY | 8 | sheep Milk Yogurt | k-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB787 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | TQTPVVVP | TQTPVVVP | 8 | sheep Milk Yogurt | β-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB788 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | YPVEPFTE | YPVEPFTE | 8 | sheep Milk Yogurt | β-Casein | 4.7 | 42C | 4h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | 0.37mg/ml | |
| FMDB789 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | GVPKVK | GVPKVK | 6 | fermented sheep Milk | β-Casein | NA | 37C | 18h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB790 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | GVPKVKE | GVPKVKE | 7 | fermented sheep Milk | β-Casein | NA | 37C | 18h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB791 | NA | Identification of peptides in traditional and probiotic sheep Milk Yogurt with angiotensin I-converting enzyme (ACE)-inhibitory activity | GVPKVKE | GVPKVKE | 7 | fermented sheep Milk | β-Casein | NA | 38C | 18h | Ace-inhibitory | In vitro | NA | ACE In hibitory activity using HHL as the substrate | L. delbrueckii subsp. bulgaricus γ10.13 and S. thermophillus γ10.7 and L. paracasei subsp. paracasei DC412 | proteinase | RPHPLC and automated, pulsed liquid-phase protein-peptide sequencer | NA | NA | NA | |
| FMDB792 | 25829629 | NA | NA | TYKEE | TYKEE | 5 | skim Milk Yogurt | αS2-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B94 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 12.41+/-0.46ug/ml |
| FMDB793 | 25829629 | NA | NA | IPP | IPP | 3 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B95 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 11.6uM |
| FMDB794 | 25829629 | NA | NA | IPP | IPP | 3 | skim Milk Yogurt | k-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B96 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 11.6uM |
| FMDB795 | 25829629 | NA | NA | YQQPVL | YQQPVL | 6 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B96 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 6.09+/-0.46ug/ml |
| FMDB796 | 25829629 | NA | NA | RINKK | RINKK | 5 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B97 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 12.05+/-0.93ug/ml |
| FMDB797 | 25829629 | NA | NA | SLPQN | SLPQN | 5 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B98 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 5.29±0.55ug/ml |
| FMDB798 | 25829629 | NA | NA | VPP | VPP | 3 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B99 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 8.4uM |
| FMDB799 | 25829629 | NA | NA | ARHPH | ARHPH | 5 | skim Milk Yogurt | k-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B100 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 9.64±3.67ug/ml |
| FMDB800 | 16162521 | NA | NA | LEIVPK | LEIVPK | 6 | caprine kefir | αS1-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 697.4 ± 0.06 | >1000 µM |
| FMDB801 | 16162521 | NA | NA | DKIHPF | DKIHPF | 6 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 755.4 ± 0.08 | >1000 µM |
| FMDB802 | 16162521 | NA | NA | KIHPFAQAQ | KIHPFAQAQ | 9 | caprine kefir | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1038.4 ± 0.02 | 132.6 ± 14.1 µM |
| FMDB803 | 16162521 | NA | NA | QLLKLK | QLLKLK | 6 | caprine kefir | αS1-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 741.5 ± 0.08 | 342.4 ± 32.1 µM |
| FMDB804 | 16162521 | NA | NA | LNVVGETVE | LNVVGETVE | 9 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 958.3 ± 0.04 | >1000 µM |
| FMDB805 | 16162521 | NA | NA | GVPKVKETMVPK | GVPKVKETMVPK | 12 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1311.5 ± 0.04 | 376.1 ± 36.9 |
| FMDB806 | 16162521 | NA | NA | GVPKVKETMVPKH | GVPKVKETMVPKH | 13 | caprine kefir | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1448.5 ± 0.08 | 223.2 ± 21.3 |
| FMDB807 | 16162521 | NA | NA | IPAIN | IPAIN | 5 | caprine kefir | k-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 526.4 ± 0.04 | 432.6 ± 41.6 |
| FMDB808 | 16162521 | NA | NA | GPFPILV | GPFPILV | 7 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 741.5 ± 0.04 | 424.0 ± 42.4 |
| FMDB809 | 16162521 | NA | NA | KFAWPQ | KFAWPQ | 6 | caprine kefir | αS2-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 775.5 ± 0.05 | 177.1 ± 14.9 |
| FMDB810 | 16162521 | NA | NA | TGPIPNSLPQ | TGPIPNSLPQ | 10 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1022.5 ± 0.02 | >1000 |
| FMDB811 | 16162521 | NA | NA | YPF | YPF | 3 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 425.2 ± 0.02 | >1000 |
| FMDB812 | 16162521 | NA | NA | HPFAQ | HPFAQ | 5 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 598.4 ± 0.04 | 465.0 ± 43.4 |
| FMDB813 | 16162521 | NA | NA | ENLLRF | ENLLRF | 6 | caprine kefir | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 790.4 ± 0.06 | 82.4 ± 8.9 |
| FMDB814 | 16162521 | NA | NA | PYVRYL | PYVRYL | 6 | caprine kefir | αS2-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 809.4 ± 0.07 | 2.4 ± 0.2 |
| FMDB815 | 16162521 | NA | NA | LVYPFTGPIPN | LVYPFTGPIPN | 11 | caprine kefir | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1216.5 ± 0.01 | 27.9 ± 2.3 |
| FMDB818 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus reuteri TMW 1.106 | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB819 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus reuteri TMW 1.106 | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB820 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus reuteri TMW 1.106 | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB821 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus reuteri TMW 1.106 | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB822 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5448 | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB823 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5448 | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB824 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5448 | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB825 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5448 | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB826 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus rossiae 34J | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB827 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus rossiae 34J | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB828 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus rossiae 34J | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB829 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus rossiae 34J | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB830 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus hammesii DSM 16381 | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB831 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus hammesii DSM 16381 | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB832 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus hammesii DSM 16381 | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB833 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus hammesii DSM 16381 | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB834 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5795 | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB835 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5795 | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB836 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5795 | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB837 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5795 | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB838 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus plantarum FUA 3002 | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB839 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus plantarum FUA 3002 | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB840 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus plantarum FUA 3002 | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB841 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus plantarum FUA 3002 | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB853 | NA | shimakage12 | ACE inhibitory substances derived from soy foods | II | II | 2 | soy protein ( Natto) | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | B.subtilis Natto + protease (end-type neutral protease, PROTIN SD-NY10) | protease | NA | NA | NA | NA |
| FMDB854 | NA | shimakage12 | ACE inhibitory substances derived from soy foods | ID | ID | 2 | soy protein ( Natto) | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | B.subtilis Natto + protease (end-type neutral protease, PROTIN SD-NY10) | protease | NA | NA | NA | NA |
| FMDB855 | NA | shimakage12 | ACE inhibitory substances derived from soy foods | IFY | IFY | 3 | soy protein ( Natto) | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | B.subtilis Natto + protease (end-type neutral protease, PROTIN SD-NY10) | protease | NA | NA | NA | NA |
| FMDB856 | NA | shimakage12 | ACE inhibitory substances derived from soy foods | LFY | LFY | 3 | soy protein ( Natto) | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | B.subtilis Natto + protease (end-type neutral protease, PROTIN SD-NY10) | protease | NA | NA | NA | NA |
| FMDB857 | NA | shimakage12 | ACE inhibitory substances derived from soy foods | LYY | LYY | 3 | soy protein ( Natto) | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | B.subtilis Natto + protease (end-type neutral protease, PROTIN SD-NY10) | protease | NA | NA | NA | NA |
| FMDB858 | NA | kuba05 | Production of angiotensin I-converting enzyme inhibitory peptides from soybean protein with Monascus purpureus acid proteinase | LAIPVNKP | LAIPVNKP | 8 | soybean proteins | b-conGlycinin | 3.3 | 37c | 10h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using pig pulmonary ACE and hippuryl-L-histidyl-L-leucine substrate | 100 units acid proteinase from M. purpureus No. 3403 | proteinase | RPHLC and automated Edman degradation with a gas/liquid-phase protein sequencer | NA | NA | 70uM |
| FMDB859 | NA | kuba05 | Production of angiotensin I-converting enzyme inhibitory peptides from soybean protein with Monascus purpureus acid proteinase | LPHF | LPHF | 4 | soybean proteins | b-conGlycinin | 3.3 | 37c | 10h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using pig pulmonary ACE and hippuryl-L-histidyl-L-leucine substrate | 100 units acid proteinase from M. purpureus No. 3403 | proteinase | RPHLC and automated Edman degradation with a gas/liquid-phase protein sequencer | NA | NA | 670uM |
| FMDB860 | NA | kuba05 | Production of angiotensin I-converting enzyme inhibitory peptides from soybean protein with Monascus purpureus acid proteinase | SPYP | SPYP | 4 | soybean proteins | Glycinin | 3.3 | 37c | 10h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using pig pulmonary ACE and hippuryl-L-histidyl-L-leucine substrate | 100 units acid proteinase from M. purpureus No. 3403 | proteinase | RPHLC and automated Edman degradation with a gas/liquid-phase protein sequencer | NA | NA | 850uM |
| FMDB861 | NA | kuba05 | Production of angiotensin I-converting enzyme inhibitory peptides from soybean protein with Monascus purpureus acid proteinase | WL | WL | 2 | soybean proteins | Glycinin | 3.3 | 37c | 10h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using pig pulmonary ACE and hippuryl-L-histidyl-L-leucine substrate | 100 units acid proteinase from M. purpureus No. 3403 | proteinase | RPHLC and automated Edman degradation with a gas/liquid-phase protein sequencer | NA | NA | 65uM |
| FMDB862 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1140.7g/mol | 0.25mg/ml |
| FMDB863 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIK | RPKHPIK | 7 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 877g/mol | 0.25mg/ml |
| FMDB864 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPI | RPKHPI | 6 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 745.4g/mol | 0.25mg/ml |
| FMDB865 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | DKIHPF | DKIHPF | 6 | WSE of Cheddar cheese | β-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 755.4g/mol | 0.14mg/ml |
| FMDB866 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1053.3g/mol | 0.11mg/ml |
| FMDB867 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | KKYKVPQLE | KKYKVPQLE | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1132.4g/mol | 0.11mg/ml |
| FMDB868 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | WSE of Cheddar cheese | β-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1881.1g/mol | 0.14mg/ml |
| FMDB869 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1140.7g/mol | 0.18mg/ml |
| FMDB870 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIK | RPKHPIK | 7 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 877g/mol | 0.18mg/ml |
| FMDB871 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPI | RPKHPI | 6 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 745.4g/mol | 0.18mg/ml |
| FMDB872 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | DKIHPF | DKIHPF | 6 | WSE of Cheddar cheese | β-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 755.4g/mol | 0.12mg/ml |
| FMDB873 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1053.3g/mol | 0.09mg/ml |
| FMDB874 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | KKYKVPQLE | KKYKVPQLE | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1132.4g/mol | 0.09mg/ml |
| FMDB875 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | WSE of Cheddar cheese | β-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1881.1g/mol | 0.17mg/ml |
| FMDB876 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1140.7g/mol | 0.20mg/ml |
| FMDB877 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIK | RPKHPIK | 7 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 877g/mol | 0.20mg/ml |
| FMDB878 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPI | RPKHPI | 6 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 745.4g/mol | 0.20mg/ml |
| FMDB879 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | DKIHPF | DKIHPF | 6 | WSE of Cheddar cheese | β-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 755.4g/mol | 0.16mg/ml |
| FMDB880 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1053.3g/mol | 0.12mg/ml |
| FMDB881 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | KKYKVPQLE | KKYKVPQLE | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1132.4g/mol | 0.12mg/ml |
| FMDB882 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | WSE of Cheddar cheese | β-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1881.1g/mol | 0.14mg/ml |
| FMDB883 | 16517684 | NA | NA | IKHQGLPQE | IKHQGLPQE | 9 | sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Anti-microbial against Enterobacter sakazakii ATCC 12868;Escherichia coli DPC5063 | In vitro | NA | well diffusion assay | L. acidophilus DPC6026 | proteinase | MALDI-TOF-MS | 1049.177 | NA | MIC;0.05mM |
| FMDB884 | PMD16517684 | NA | NA | VLNENLLR | VLNENLLR | 8 | sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Anti-microbial against Enterobacter sakazakii ATCC 12868;Escherichia coli DPC5063 | In vitro | NA | well diffusion assay | L. acidophilus DPC6026 | proteinase | MALDI-TOF-MS | 970.119 | NA | MIC;0.22mM |
| FMDB885 | PMD16517684 | NA | NA | SDIPNPI G SENSEK | SDIPNPI G SENSEK | 16 | sodium Caseinate | αS1-Casein | 7 | 37c | 24h | Anti-microbial against Enterobacter sakazakii ATCC 12868;Escherichia coli DPC5063 | In vitro | NA | well diffusion assay | L. acidophilus DPC6026 | proteinase | MALDI-TOF-MS | 1486.7 | NA | MIC;1.0mM |
| FMDB886 | 22642665 | NA | NA | IKHQGLPQE | IKHQGLPQE | 9 | sodium Caseinate | αS1-Casein | NA | 37c | 17h | Anti-microbial against Cronobacter sakazakii DPC 6440 | In vitro | NA | 96 well antimicrobial assay | Bacillus cereus | proteases | MALDI-TOF-MS | NA | 1049 Da | NA |
| FMDB887 | 22642665 | NA | NA | VLNENLLR | VLNENLLR | 8 | sodium Caseinate | αS1-Casein | NA | 37c | 17h | Anti-microbial against Cronobacter sakazakii DPC 6440 | In vitro | NA | 97 well antimicrobial assay | Bacillus cereus | proteases | MALDI-TOF-MS | NA | 970Da | NA |
| FMDB888 | 22642665 | NA | NA | IKHQGLPQE | IKHQGLPQE | 9 | sodium Caseinate | αS1-Casein | NA | 37c | 17h | Anti-microbial against Cronobacter sakazakii DPC 6440 | In vitro | NA | 98 well antimicrobial assay | Bacillus thuringiensis | proteases | MALDI-TOF-MS | NA | 1049 Da | NA |
| FMDB889 | 22642665 | NA | NA | VLNENLLR | VLNENLLR | 8 | sodium Caseinate | αS1-Casein | NA | 37c | 17h | Anti-microbial against Cronobacter sakazakii DPC 6440 | In vitro | NA | 99 well antimicrobial assay | Bacillus thuringiensis | proteases | MALDI-TOF-MS | NA | 970 Da | NA |
| FMDB1010 | NA | kuba09 | Angiotensin I-converting enzyme inhibitory peptides in red-mold rice made by Monascus purpureus | IY | IY | 2 | Red mold rice ( non glutinous rice) | NA | NA | 30C | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | M. purpureus IFO 4489 | proteinase | Automated Edman degradation with a gas/liquid phase protein sequencer | NA | NA | 4uM |
| FMDB1011 | NA | Angiotensin I-converting enzyme inhibitory peptides in red-mold rice made by Monascus purpureus | VVY | VVY | 3 | Red mold rice ( non glutinous rice) | NA | NA | 30C | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | M. purpureus IFO 4489 | proteinase | Automated Edman degradation with a gas/liquid phase protein sequencer | NA | NA | 22.0uM | |
| FMDB1012 | NA | Angiotensin I-converting enzyme inhibitory peptides in red-mold rice made by Monascus purpureus | VF | VF | 2 | Red mold rice ( non glutinous rice) | NA | NA | 30C | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | M. purpureus IFO 4489 | proteinase | Automated Edman degradation with a gas/liquid phase protein sequencer | NA | NA | 49.7uM | |
| FMDB1013 | NA | Angiotensin I-converting enzyme inhibitory peptides in red-mold rice made by Monascus purpureus | VW | VW | 2 | Red mold rice ( non glutinous rice) | NA | NA | 30C | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | M. purpureus IFO 4489 | proteinase | Automated Edman degradation with a gas/liquid phase protein sequencer | NA | NA | 3.1uM | |
| FMDB1195 | 25218972 | NA | NA | LAFNPTQLEGQCHV | LAFNPTQLEGQCHV | 14 | Sheep cheese Whey | ovine βlactoglobulin, f(149–162) | NA | 45c | 4h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Bacillus sp.P7 | protease | nano-ESI-MS | 778.8811 | NA | NA |
| FMDB1196 | 25218972 | NA | NA | LAFNPTQLEGQCHV | LAFNPTQLEGQCHV | 14 | Sheep cheese Whey | ovine βlactoglobulin, f(149–162) | NA | 45c | 4h | Antioxidant | In vitro | NA | ABTS radical scavenging assay | Bacillus sp.P7 | protease | nano-ESI-MS | 778.8811 | NA | NA |
| FMDB1197 | NA | otte11 | Influence of fermentation temperature and autolysis on ACE-inhibitory activity and peptide profiles of Milk fermented by selected strains of Lactobacillus helveticus and Lactococcus lactis | YAKPA | YAKPA | 5 | Fermented bovine Milk | k-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 549.3 | NA |
| FMDB1198 | NA | Influence of fermentation temperature and autolysis on ACE-inhibitory activity and peptide profiles of Milk fermented by selected strains of Lactobacillus helveticus and Lactococcus lactis | PQLEI | PQLEI | 5 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 600.4 | NA | |
| FMDB1199 | 10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1140.9 | NA |
| FMDB1200 | 10908049 | NA | NA | KKIEKFQSE | KKIEKFQSE | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1216.8 | NA |
| FMDB1201 | 10908049 | NA | NA | KAVPYPQE | KAVPYPQE | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 802.6 | NA |
| FMDB1202 | 10908049 | NA | NA | KIEKFQSEE | KIEKFQSEE | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1217.6 | NA |
| FMDB1203 | 10908049 | NA | NA | FVAPFPQV | FVAPFPQV | 8 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 905.6 | NA |
| FMDB1204 | 10966406 | NA | NA | NVPGEIVE | NVPGEIVE | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 856.5 | NA |
| FMDB1205 | 10966406 | NA | NA | TESQSLTLT | TESQSLTLT | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 979.7 | NA |
| FMDB1206 | 10966406 | NA | NA | QSKVLPVPE | QSKVLPVPE | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 997.7 | NA |
| FMDB1207 | 10966406 | NA | NA | SLSQSKVLPVPE | SLSQSKVLPVPE | 12 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1283 | NA |
| FMDB1208 | 10966406 | NA | NA | KVKPVPEKAVPYPQ | KVKPVPEKAVPYPQ | 14 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1564 0.7 | NA |
| FMDB1209 | 10966406 | NA | NA | ELQDKIHPF | ELQDKIHPF | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1126.8 | NA |
| FMDB1210 | 10966406 | NA | NA | DELQDKIHPF | DELQDKIHPF | 10 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1241.8 | NA |
| FMDB1211 | 10966406 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 977.7 | NA |
| FMDB1212 | 10966406 | NA | NA | GVSKVEAMAPKHKEM PFPKYPVQPF | GVSKVEAMAPKHKEM PFPKYPVQPF | 26 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 2973.3 | NA |
| FMDB1213 | 10966406 | NA | NA | VMFPPQSVL | VMFPPQSVL | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1017.6 | NA |
| FMDB1214 | 10966406 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1152 | NA |
| FMDB1215 | 10966406 | NA | NA | TQTPVVVPPFLQPEVM | TQTPVVVPPFLQPEVM | 16 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1782.7 | NA |
| FMDB1216 | 10966406 | NA | NA | QQPVLGPVRGPFPIIV | QQPVLGPVRGPFPIIV | 16 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1718.6 | NA |
| FMDB1217 | 10966406 | NA | NA | YQQPVLGPVRGPFPIIV | YQQPVLGPVRGPFPIIV | 17 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. lactis CHCC3906 | proteinase | LC-MS/MS | NA | 1881.7 | NA |
| FMDB1218 | 10966406 | NA | NA | YAKPA | YAKPA | 5 | Fermented bovine Milk | k-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 549.3 | NA |
| FMDB1219 | 10966406 | NA | NA | PQLEI | PQLEI | 5 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 600.4 | NA |
| FMDB1220 | 10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1140.9 | NA |
| FMDB1221 | 10908049 | NA | NA | KKIEKFQSE | KKIEKFQSE | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1216.8 | NA |
| FMDB1222 | 10908049 | NA | NA | KAVPYPQE | KAVPYPQE | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 802.6 | NA |
| FMDB1223 | 10908049 | NA | NA | KIEKFQSEE | KIEKFQSEE | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1217.6 | NA |
| FMDB1224 | 10908049 | NA | NA | FVAPFPQV | FVAPFPQV | 8 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 905.6 | NA |
| FMDB1225 | 10966406 | NA | NA | NVPGEIVE | NVPGEIVE | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 856.5 | NA |
| FMDB1226 | 10966406 | NA | NA | TESQSLTLT | TESQSLTLT | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 979.7 | NA |
| FMDB1227 | 10966406 | NA | NA | QSKVLPVPE | QSKVLPVPE | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 997.7 | NA |
| FMDB1228 | 10966406 | NA | NA | SLSQSKVLPVPE | SLSQSKVLPVPE | 12 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1283 | NA |
| FMDB1229 | 10966406 | NA | NA | KVKPVPEKAVPYPQ | KVKPVPEKAVPYPQ | 14 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1564 0.7 | NA |
| FMDB1230 | 10966406 | NA | NA | ELQDKIHPF | ELQDKIHPF | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1126.8 | NA |
| FMDB1231 | 10966406 | NA | NA | DELQDKIHPF | DELQDKIHPF | 10 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1241.8 | NA |
| FMDB1232 | 10966406 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 977.7 | NA |
| FMDB1233 | 10966406 | NA | NA | GVSKVEAMAPKHKEM PFPKYPVQPF | GVSKVEAMAPKHKEM PFPKYPVQPF | 26 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 2973.3 | NA |
| FMDB1234 | 10966406 | NA | NA | VMFPPQSVL | VMFPPQSVL | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1017.6 | NA |
| FMDB1235 | 10966406 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1152 | NA |
| FMDB1236 | 10966406 | NA | NA | TQTPVVVPPFLQPEVM | TQTPVVVPPFLQPEVM | 16 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1782.7 | NA |
| FMDB1237 | 10966406 | NA | NA | QQPVLGPVRGPFPIIV | QQPVLGPVRGPFPIIV | 16 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1718.6 | NA |
| FMDB1238 | 10966406 | NA | NA | YQQPVLGPVRGPFPIIV | YQQPVLGPVRGPFPIIV | 17 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lc. lactis ssp. cremoris F3 | proteinase | LC-MS/MS | NA | 1881.7 | NA |
| FMDB1239 | 10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 1140.9 | NA |
| FMDB1240 | 10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1140.9 | NA |
| FMDB1241 | 10908049 | NA | NA | FPGP | FPGP | 4 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 417.3 | NA |
| FMDB1242 | 10908049 | NA | NA | FPGP | FPGP | 4 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 417.3 | NA |
| FMDB1243 | 10908049 | NA | NA | RPKHPI | RPKHPI | 6 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 747.6 | NA |
| FMDB1244 | 10908049 | NA | NA | KAVPYPQE | KAVPYPQE | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 802.6 | NA |
| FMDB1245 | 10908049 | NA | NA | KAVPYPQE | KAVPYPQE | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 802.6 | NA |
| FMDB1246 | 10908049 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Fermented bovine Milk | αS1-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1536.4 | NA |
| FMDB1247 | 10908049 | NA | NA | TESQSLTLT | TESQSLTLT | 9 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 979.7 | NA |
| FMDB1248 | 10966406 | NA | NA | NVPGEIVE | NVPGEIVE | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 856.4 | NA |
| FMDB1249 | 10966406 | NA | NA | NVPGEIVE | NVPGEIVE | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 856.4 | NA |
| FMDB1250 | 10966406 | NA | NA | SWM | SWM | 3 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 423.1 | NA |
| FMDB1251 | 10966406 | NA | NA | SWM | SWM | 3 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 423.1 | NA |
| FMDB1252 | 10966406 | NA | NA | KVLPVPE | KVLPVPE | 7 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 780.6 | NA |
| FMDB1253 | 10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 756.4 | NA |
| FMDB1254 | 10966406 | NA | NA | SLSQKVLPVPE | SLSQKVLPVPE | 11 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1282.8 | NA |
| FMDB1255 | 10966406 | NA | NA | SLSQKVLPVPE | SLSQKVLPVPE | 11 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 1282.8 | NA |
| FMDB1256 | 10966406 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 977.7 | NA |
| FMDB1257 | 10966406 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 977.7 | NA |
| FMDB1258 | 10966406 | NA | NA | VLPVPE KAVPYPQ | VLPVPE KAVPYPQ | 14 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1436.3 | NA |
| FMDB1259 | 10966406 | NA | NA | DELQDKIHPF | DELQDKIHPF | 10 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 1241.6 | NA |
| FMDB1260 | 10966406 | NA | NA | DELQDKIHPF | DELQDKIHPF | 10 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1241.6 | NA |
| FMDB1261 | 10966406 | NA | NA | SEEQQQTEDELQDKIHPF | SEEQQQTEDELQDKIHPF | 18 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 2282.4 | NA |
| FMDB1262 | 10966406 | NA | NA | SEEQQQTEDELQDKIHPF | SEEQQQTEDELQDKIHPF | 18 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 2282.4 | NA |
| FMDB1263 | 10966406 | NA | NA | KKIEK..KIHPF | KKIEK..KIHPF | 12 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 3184.9 | NA |
| FMDB1264 | 10966406 | NA | NA | KKIEK..KIHPF | KKIEK..KIHPF | 12 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 3184.9 | NA |
| FMDB1265 | 10966406 | NA | NA | VYPFPGPIPN | VYPFPGPIPN | 10 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1100.8 | NA |
| FMDB1266 | 10966406 | NA | NA | VYPFPGPIHNSLPQ | VYPFPGPIHNSLPQ | 14 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 1565.7 | NA |
| FMDB1267 | 10966406 | NA | NA | VYPFPGPIHNSLPQ | VYPFPGPIHNSLPQ | 14 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1565.7 | NA |
| FMDB1268 | 10966406 | NA | NA | HKEMPFPKYPVQPF | HKEMPFPKYPVQPF | 14 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 1746.1 | NA |
| FMDB1269 | 10966406 | NA | NA | HKEMPFPKYPVQPF | HKEMPFPKYPVQPF | 14 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1746.1 | NA |
| FMDB1270 | 10966406 | NA | NA | MAPKHKEMPFPKYPVQPF | MAPKHKEMPFPKYPVQPF | 18 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 2172.4 | NA |
| FMDB1271 | 10966406 | NA | NA | MAPKHKEMPFPKYPVQPF | MAPKHKEMPFPKYPVQPF | 18 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 2172.4 | NA |
| FMDB1272 | 10966406 | NA | NA | QQPVLGPVRGPFPIIV | QQPVLGPVRGPFPIIV | 16 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 1718.6 | NA |
| FMDB1273 | 10966406 | NA | NA | QQPVLGPVRGPFPIIV | QQPVLGPVRGPFPIIV | 16 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1718.6 | NA |
| FMDB1274 | 10966406 | NA | NA | YQQPVLGPVRGPFPIIV | YQQPVLGPVRGPFPIIV | 17 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 1881.3 | NA |
| FMDB1275 | 10966406 | NA | NA | SLPQNIPPLTQTPVV.QPEVM | SLPQNIPPLTQTPVV.QPEVM | 21 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 2742.9 | NA |
| FMDB1276 | 10966406 | NA | NA | SLPQNIPPLTQTPVV.QPEVM | SLPQNIPPLTQTPVV.QPEVM | 21 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 2742.9 | NA |
| FMDB1277 | 10966406 | NA | NA | NIPPLTQTPVVVPPFLQPEVM | NIPPLTQTPVVVPPFLQPEVM | 21 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 2317.8 | NA |
| FMDB1278 | 10966406 | NA | NA | NIPPLTQTPVVVPPFLQPEVM | NIPPLTQTPVVVPPFLQPEVM | 21 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 2317.8 | NA |
| FMDB1279 | 10966406 | NA | NA | NIPPLTQTPVV...QPEVMGVS | NIPPLTQTPVV...QPEVMGVS | 22 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | NA | NA | NA | NA | Lb. helveticus strains MI1198 | proteinase | LC-MS/MS | NA | 2560.8 | NA |
| FMDB1280 | 10966406 | NA | NA | SLPQNIPPLTQTPVV.AMAPK | SLPQNIPPLTQTPVV.AMAPK | 21 | Fermented bovine Milk | β-Casein | 4.6 | 30c | 24h | Ace-inhibitory | In vitro | NA | spectrophotometric assay usimg FAPGG and ACE from rabbit lung | Lb. helveticus strainsCHCC4080 | proteinase | LC-MS/MS | NA | 3969.1 | NA |
| FMDB1281 | NA | ahira05 | Effect of Powdered Fermented Milk with Lactobacillus helveticus on Subjects with High-Normal Blood Pressure or Mild Hypertension | VPP | VPP | 3 | powdered fermented Milk | Casein | NA | 37c | 22h | NA | NA | NA | NA | L. helveticus CM4 | proteinase | NA | NA | NA | NA |
| FMDB1282 | NA | ahira05 | NA | IPP | IPP | 3 | powdered fermented Milk | Casein | NA | 37c | 22h | NA | NA | NA | NA | L. helveticus CM4 | proteinase | NA | NA | NA | NA |
| FMDB1283 | NA | kajimoto02 | Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)” | IPP | IPP | 3 | Yogurt | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | L. helveticus and S. cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB1284 | NA | kajimoto02 | Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)” | IPP | IPP | 3 | Yogurt | k-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | L. helveticus and S. cerevisiae | Proteinase | NA | NA | NA | 5 micro mol /l |
| FMDB1285 | NA | kajimoto02 | Hypotensive effects of tablets containing “lactotripeptides (VPP, IPP)” | VPP | VPP | 3 | Yogurt | β-Casein | NA | NA | NA | Anti-hypertensive | In vivo | Spontaneously Hypertensive Rats | NA | L. helveticus and S. cerevisiae | Proteinase | NA | NA | NA | 9micromol/l |
| FMDB1290 | NA | li15 | Purification and identification of novel peptides with inhibitory effect against angiotensin I-converting enzyme and optimization of process conditions in Milk fermented with the yeast Kluyveromyces marxianus | VLSRYP | VLSRYP | 6 | Fermented Milk (reconstituted skim Milk) | k-Casein | 4.3 | 32c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay By HPLC | Kluyveromyces marxianus Z17 | proteinase and peptidase | MALDI/TOF-TOF MS/MS | NA | NA | 36.7 uM |
| FMDB1291 | NA | li15 | NA | LRFF | LRFF | 4 | Fermented Milk (reconstituted skim Milk) | αS1-Casein | 4.3 | 32c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay By HPLC | Kluyveromyces marxianus Z17 | proteinase and peptidase | MALDI/TOF-TOF MS/MS | NA | NA | 116.9uM |
| FMDB1648 | Rizello 2005 | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | GLSPEVLNENLL | GLSPEVLNENLL | 12 | WSE of Pecorino Romano cheese | Sheep αS1- Casein | 5.3 | 45-46C cooking ; ripenin 10mo | 10monthold | Antibacterial | In vitro | NA | NA | natural culture in scotta | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1297.6 | NA | |
| FMDB1649 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | RFVVAPFPE | RFVVAPFPE | 9 | WSE of Pecorino Romano cheese | Sheep αS1-Casein | 5.3 | 45-46C cooking ; ripenin 10mo | 10monthold | Antibacterial | In vitro | NA | NA | natural culture in scotta | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1061.7 | NA | |
| FMDB1650 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | VVAPFPEV | VVAPFPEV | 8 | WSE of Pecorino Romano cheese | Sheep αS1-Casein | 5.3 | 45-46C cooking ; ripenin 10mo | 10monthold | Antibacterial | In vitro | NA | NA | natural culture in scotta | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 857.5 | NA | |
| FMDB1651 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | VMFPPQSVL | VMFPPQSVL | 9 | WSE of Pecorino Romano cheese | Sheep β-Casein | 5.3 | 45-46C cooking ; ripenin 10mo | 10monthold | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural culture in scotta | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1017.4 | NA | |
| FMDB1652 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | MAIPPKKNQD | MAIPPKKNQD | 10 | WSE of Canestrato Pugliese cheese | Cow k-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1141.5 | NA | |
| FMDB1653 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | TVQVTSTAV | TVQVTSTAV | 9 | WSE of Canestrato Pugliese cheese | Cow k-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 905.3 | NA | |
| FMDB1654 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | MPIQAF | MPIQAF | 6 | WSE of Canestrato Pugliese | Sheep β-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 706.4 | NA | |
| FMDB1655 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | FVAPFPEVFG | FVAPFPEVFG | 10 | WSE of Canestrato Pugliese | cow αS1-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1109.5 | NA | |
| FMDB1656 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | GKEKVNELSKD | GKEKVNELSKD | 11 | WSE of Canestrato Pugliese cheese | cow αS1-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1246.7 | NA | |
| FMDB1657 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | FVAPFPEVFG | FVAPFPEVFG | 10 | WSE of Canestrato Pugliese cheese | cow αS1-Casein | 5 | NA | 6month old ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Whey culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1109.5 | NA | |
| FMDB1658 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | RPKHPIK | RPKHPIK | 7 | WSE of Caciocavallo | cow αS1-Casein | 5.2 | stretching at 90-95C | 3 monthold ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Milk culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 875.6 | NA | |
| FMDB1659 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | GLPQE | GLPQE | 5 | WSE of Caciocavallo cheese | cow αS1-Casein | 5.2 | stretching at 90-95C | 4 monthold ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | natural Milk culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 543.1 | NA | |
| FMDB1660 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | MAIPPKKNQD | MAIPPKKNQD | 10 | WSE of Crescenza cheese | Cow k-Casein | 5.6 | NA | 7days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | freeze dried culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1141.5 | NA | |
| FMDB1661 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | WSE of Crescenza | Cow β-Casein | 5.6 | NA | 7days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | freeze dried culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1881.3 | NA | |
| FMDB1662 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | MPIQAFLL | MPIQAFLL | 8 | WSE of Crescenza cheese | Cow β-Casein | 5.6 | NA | 7days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | freeze dried culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 932.5 | NA | |
| FMDB1663 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | FVAPFPEVFG | FVAPFPEVFG | 10 | WSE of Crescenza cheese | cow αS1-Casein | 5.6 | NA | 7days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | freeze dried culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1109.4 | NA | |
| FMDB1664 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Crescenza cheese | cow αS1-Casein | 5.6 | NA | 7days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | freeze dried culture | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1052.7 | NA | |
| FMDB1665 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | YPFTGPIPN | YPFTGPIPN | 9 | WSE of Caprino del piemonte cheese | Goat β-Casein | 4.7 | NA | 30days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | NA | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 1005.5 | NA | |
| FMDB1666 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | MPIQA | MPIQA | 5 | WSE of Caprino del piemonte | Goat β-Casein | 4.7 | NA | 30days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | NA | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 559.2 | NA | |
| FMDB1667 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | VFMFPPQSV | VFMFPPQSV | 9 | WSE of Caprino del piemonte cheese | Goat β-Casein | 4.7 | NA | 30days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | NA | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 904.4 | NA | |
| FMDB1668 | NA | Antibacterial Activities of Peptides from the Water-Soluble Extracts of Italian cheese Varieties | VVAPFPE | VVAPFPE | 7 | WSE of Caprino del piemonte cheese | Goat αS1-Casein | 4.7 | NA | 30days ripening | Antibacterial | In vitro | NA | Well diffusion and Microtitre plate assay using Indicator bacteria E. coli K12, Y. enterocolitica X8, B.megaterium F6, and L. innocua DSM 20649 , Staph. aureus ATCC25923 and L. lactis spp. cremoris WG2 , Salmonella spp. , and L. sakei A15 and L.helveticus PR4 | NA | proteolytic enzyme | HPLC coupled to electrospray ionization-ion trap (ESI-IT) mass spectrometry (MS) | NA | 758.4 | NA | |
| FMDB1671 | NA | lozo11 | Comparative analysis of b-Casein proteolysis by PrtP proteinase from Lactobacillus paracasei subsp. paracasei BGHN14, PrtR proteinase from Lactobacillus rhamnosus BGT10 and PrtH proteinase from Lactobacillus helveticus BGRA43 | SLSQS | SLSQS | 5 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinases PrtP | LC MS/MS | NA | 519.9 da | NA |
| FMDB1672 | NA | lozo11 | NA | LPVPQ | LPVPQ | 5 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 552.3 Da | NA |
| FMDB1673 | NA | lozo11 | NA | LTDVE | LTDVE | 5 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 574.9Da | NA |
| FMDB1674 | NA | lozo11 | NA | QEPV | QEPV | 4 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 584.1Da | NA |
| FMDB1675 | NA | lozo11 | NA | QEPV | QEPV | 4 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 584.1Da | NA |
| FMDB1676 | NA | lozo11 | NA | QEPV | QEPV | 4 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 584.1Da | NA |
| FMDB1677 | NA | lozo11 | NA | DMPIQ | DMPIQ | 5 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 601.9Da | NA |
| FMDB1678 | NA | lozo11 | NA | DMPIQ | DMPIQ | 5 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 601.9Da | NA |
| FMDB1679 | NA | lozo11 | NA | DMPIQ | DMPIQ | 5 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 601.9Da | NA |
| FMDB1680 | NA | lozo11 | NA | VPYPQ | VPYPQ | 5 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 602.2 da | NA |
| FMDB1681 | NA | lozo11 | NA | FTESQ | FTESQ | 5 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 609.9 da | NA |
| FMDB1682 | NA | lozo11 | NA | GPFPII | GPFPII | 6 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 642.1 da | NA |
| FMDB1683 | NA | lozo11 | NA | EAMAPK | EAMAPK | 6 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 645.1 da | NA |
| FMDB1684 | NA | lozo11 | NA | DMPIQA | DMPIQA | 6 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 672.9 da | NA |
| FMDB1685 | NA | lozo11 | NA | DMPIQA | DMPIQA | 6 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 672.9 da | NA |
| FMDB1686 | NA | lozo11 | NA | AVPYPQ | AVPYPQ | 6 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 673.1Da | NA |
| FMDB1687 | NA | lozo11 | NA | TLTDVE | TLTDVE | 6 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 676.1 Da | NA |
| FMDB1688 | NA | lozo11 | NA | TDVENL | TDVENL | 6 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 689.1da | NA |
| FMDB1689 | NA | lozo11 | NA | HNSLPQ | HNSLPQ | 6 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 695.2 da | NA |
| FMDB1690 | NA | lozo11 | NA | VEPFTE | VEPFTE | 6 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 720.1da | NA |
| FMDB1691 | NA | lozo11 | NA | QEPVLGP | QEPVLGP | 7 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 739.1da | NA |
| FMDB1692 | NA | lozo11 | NA | GPFPIIV | GPFPIIV | 7 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 741.3 Da | NA |
| FMDB1693 | NA | lozo11 | NA | YQEPVL | YQEPVL | 6 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 747.1 da | NA |
| FMDB1694 | NA | lozo11 | NA | YQEPVL | YQEPVL | 6 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 747.1da | NA |
| FMDB1695 | NA | lozo11 | NA | DKIHPF | DKIHPF | 6 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 755.3 da | NA |
| FMDB1696 | NA | lozo11 | NA | RDMPIQ | RDMPIQ | 6 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 758.7 da | NA |
| FMDB1697 | NA | lozo11 | NA | RDMPIQ | RDMPIQ | 6 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 758.7 Da | NA |
| FMDB1698 | NA | lozo11 | NA | HQPLPPT | HQPLPPT | 7 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 788.2 Da | NA |
| FMDB1699 | NA | lozo11 | NA | KVLPVPQ | KVLPVPQ | 7 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 779.4 Da | NA |
| FMDB1700 | NA | lozo11 | NA | KAVPYPQ | KAVPYPQ | 7 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 801.3 Da | NA |
| FMDB1701 | NA | lozo11 | NA | LTDVENL | LTDVENL | 7 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 802.2 Da | NA |
| FMDB1702 | NA | lozo11 | NA | GVSKVKEA | GVSKVKEA | 8 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 816.3Da | NA |
| FMDB1703 | NA | lozo11 | NA | SVLSLSQS | SVLSLSQS | 8 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 819.2Da | NA |
| FMDB1704 | NA | lozo11 | NA | GPVRGPFP | GPVRGPFP | 8 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 825.4Da | NA |
| FMDB1705 | NA | lozo11 | NA | GPVRGPFP | GPVRGPFP | 8 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 825.4Da | NA |
| FMDB1706 | NA | lozo11 | NA | RDMPIQA | RDMPIQA | 7 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 829.4Da | NA |
| FMDB1707 | NA | lozo11 | NA | TLTDVENL | TLTDVENL | 8 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 903.2Da | NA |
| FMDB1708 | NA | lozo11 | NA | LLYQEPVL | LLYQEPVL | 8 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 973.3Da | NA |
| FMDB1709 | NA | lozo11 | NA | RDMPIQAF | RDMPIQAF | 8 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 976.4Da | NA |
| FMDB1710 | NA | lozo11 | NA | KVKEAMAPK | KVKEAMAPK | 9 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 1000.4Da | NA |
| FMDB1711 | NA | lozo11 | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 1150.7Da | NA |
| FMDB1712 | NA | lozo11 | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 1150.7Da | NA |
| FMDB1713 | NA | lozo11 | NA | DELQDKIHPF | DELQDKIHPF | 10 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 1240.4Da | NA |
| FMDB1714 | NA | lozo11 | NA | HQPHQPLPPTVM | HQPHQPLPPTVM | 12 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 1380.4Da | NA |
| FMDB1715 | NA | lozo11 | NA | QEPVLGPVRGPFP | QEPVLGPVRGPFP | 13 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 1391.5Da | NA |
| FMDB1716 | NA | lozo11 | NA | QEPVLGPVRGPFP | QEPVLGPVRGPFP | 13 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 1391.5Da | NA |
| FMDB1717 | NA | lozo11 | NA | YQEPVLGPVRGPFP | YQEPVLGPVRGPFP | 14 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 1554.5Da | NA |
| FMDB1718 | NA | lozo11 | NA | YQEPVLGPVRGPFP | YQEPVLGPVRGPFP | 14 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 1554.5Da | NA |
| FMDB1719 | NA | lozo11 | NA | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 1716.9Da | NA |
| FMDB1720 | NA | lozo11 | NA | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 1716.9Da | NA |
| FMDB1721 | NA | lozo11 | NA | HKEMPFPKYPVEPF | HKEMPFPKYPVEPF | 14 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 1745.3Da | NA |
| FMDB1722 | NA | lozo11 | NA | LLYQEPVLGPVRGPFP | LLYQEPVLGPVRGPFP | 16 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 1780.9Da | NA |
| FMDB1723 | NA | lozo11 | NA | HQPHQPLPPTVMFPPQ | HQPHQPLPPTVMFPPQ | 16 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 1849.9Da | NA |
| FMDB1724 | NA | lozo11 | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 1879.9Da | NA |
| FMDB1725 | NA | lozo11 | NA | MHQPHQPLPPTVMFPPQ | MHQPHQPLPPTVMFPPQ | 17 | Beta Casein | β-Casein | 6.8 | 30C | 3h | NA | NA | NA | NA | Lactobacillus paracasei subsp. paracasei BGHN14 | cell-envelope proteinasesPrtP | LC MS/MS | NA | 1980.8Da | NA |
| FMDB1726 | NA | lozo11 | NA | SEEQQQTEDELQKIHPF | SEEQQQTEDELQKIHPF | 17 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 2279.8Da | NA |
| FMDB1727 | NA | lozo11 | NA | KKIEKFQSEEQQQTEDELQ | KKIEKFQSEEQQQTEDELQ | 19 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 2444.5Da | NA |
| FMDB1728 | NA | lozo11 | NA | KIEKFQSEEQQQTEDELQDKIHPF | KIEKFQSEEQQQTEDELQDKIHPF | 24 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 3053.4Da | NA |
| FMDB1729 | NA | lozo11 | NA | KKIEKFQSEEQQQTEDELQDKIHPF | KKIEKFQSEEQQQTEDELQDKIHPF | 25 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 3181.6Da | NA |
| FMDB1730 | NA | lozo11 | NA | KIEKFQSEEQQQTEDELQDKIHPFAQTQ | KIEKFQSEEQQQTEDELQDKIHPFAQTQ | 28 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 3481.8Da | NA |
| FMDB1731 | NA | lozo11 | NA | RELEELNVPGEIVESLSSSEESITRIN | RELEELNVPGEIVESLSSSEESITRIN | 27 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 3348.4Da | NA |
| FMDB1732 | NA | lozo11 | NA | RELEELNVPGEIVESLSSSEESITRIN | RELEELNVPGEIVESLSSSEESITRIN | 27 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 3348.4Da | NA |
| FMDB1733 | NA | lozo11 | NA | RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQ | RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQ | 46 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus rhamnosus BGT10 | cell-envelope proteinasesPrtR | LC MS/MS | NA | 5775.6Da | NA |
| FMDB1734 | NA | lozo11 | NA | RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQ | RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQ | 46 | Beta Casein | β-Casein | 6.8 | 37C | 3h | NA | NA | NA | NA | Lactobacillus helveticus BGRA43 | cell-envelope proteinasesPrtH | LC MS/MS | NA | 5775.6Da | NA |
| FMDB1735 | 26616950;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Casein (raw Milk) | αS2-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1736 | 26616950;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Casein (Heat treated Milk with open vials) | αS2-Casein | NA | 24 C and then at 4c | 25 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1737 | 26616950;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Casein (Heat treated Milk with closed vials) | αS2-Casein | NA | 25 C and then at 4c | 26 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1738 | 26616950;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Casein (Kefir) | αS2-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1739 | 26616950; 8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Casein (raw Milk) | αS2-Casein | NA | 24 C and then at 4c | 25 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1740 | 26616950; 8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Casein (Heat treated Milk with open vials) | αS2-Casein | NA | 25 C and then at 4c | 26 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1741 | 26616950; 8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Casein (Heat treated Milk with closed vials) | αS2-Casein | NA | 26 C and then at 4c | 27 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1742 | 26616950; 8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Casein (Kefir) | αS2-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1743 | 26616950;7790570 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein (raw Milk) | β-Casein | NA | 24 C and then at 4c | 25 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1744 | 26616950;7790570 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 25 C and then at 4c | 26 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1745 | 26616950;7790570 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 26 C and then at 4c | 27 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1746 | 26616950;7790570 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1747 | 26616950; Maruyama et al., 1985 | NA | Angiotensin I-Converting EnzymeInhibitor Derived from anEnzymatic Hydrolysate of Casein. II. Isolation and Bradykinin-potentiating Activity on the Uterus and the Ileum of Rats | AVPYPQR | AVPYPQR | 7 | Casein (raw Milk) | b-Casokinin-7 | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1748 | 26616950; Maruyama et al., 1985 | NA | NA | AVPYPQR | AVPYPQR | 7 | Casein (Heat treated Milk with open vials) | b-Casokinin-7 | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1749 | 26616950; Maruyama et al., 1985 | NA | NA | AVPYPQR | AVPYPQR | 7 | Casein (Heat treated Milk with closed vials) | b-Casokinin-7 | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1750 | 26616950; Maruyama et al., 1985 | NA | NA | AVPYPQR | AVPYPQR | 7 | Casein (Kefir) | b-Casokinin-7 | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1751 | 26616950;12058981 | NA | NA | YPFPGPI | YPFPGPI | 7 | Casein (raw Milk) | b-Casomorphin-7 | NA | 23 C and then at 4c | 24 h +24h | Opioid agonist | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1752 | 26616950;12058981 | NA | NA | YPFPGPI | YPFPGPI | 7 | Casein (Heat treated Milk with open vials) | b-Casomorphin-7 | NA | 23 C and then at 4c | 24 h +24h | Opioid agonist | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1753 | 26616950;12058981 | NA | NA | YPFPGPI | YPFPGPI | 7 | Casein (Heat treated Milk with closed vials) | b-Casomorphin-7 | NA | 23 C and then at 4c | 24 h +24h | Opioid agonist | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1754 | 26616950;12058981 | NA | NA | YPFPGPI | YPFPGPI | 7 | Casein (Kefir) | b-Casomorphin-7 | NA | 23 C and then at 4c | 24 h +24h | Opioid agonist | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1755 | 26616950;19054235 | NA | NA | YQEPVLGPVRGPFPI | YQEPVLGPVRGPFPI | 15 | Casein (Kefir) | Casecidin-15 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1756 | 26616950;1169462 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein (raw Milk) | Casecidin-17 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial;Antithrombotic;Immunomodulatory;Antioxidant | NA | NA | NA | NA | Proteases | NA | NA | NA | NA |
| FMDB1757 | 26616950;1169462 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein (Heat treated Milk with open vials) | Casecidin-17 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial;Antithrombotic;Immunomodulatory;Antioxidant | NA | NA | NA | NA | Proteases | NA | NA | NA | NA |
| FMDB1758 | 26616950;1169462 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein (Heat treated Milk with closed vials) | Casecidin-17 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial;Antithrombotic;Immunomodulatory;Antioxidant | NA | NA | NA | NA | Proteases | NA | NA | NA | NA |
| FMDB1759 | 26616950;1169462 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein (Kefir) | Casecidin-17 | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial;Antithrombotic;Immunomodulatory;Antioxidant | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1760 | 26616950;16517684 | NA | NA | EVFGKEKVN | EVFGKEKVN | 9 | Casein (raw Milk) | Caseicin B | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1761 | 26616950;16517684 | NA | NA | EVFGKEKVN | EVFGKEKVN | 9 | Casein (Heat treated Milk with open vials) | Caseicin B | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1762 | 26616950;16517684 | NA | NA | EVFGKEKVN | EVFGKEKVN | 9 | Casein (Heat treated Milk with closed vials) | Caseicin B | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1763 | 26616950;16517684 | NA | NA | SDIPNPIGSENSEK | SDIPNPIGSENSEK | 14 | Casein (raw Milk) | Caseicin C | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1764 | 26616950;16517684 | NA | NA | SDIPNPIGSENSEK | SDIPNPIGSENSEK | 14 | Casein (Heat treated Milk with open vials) | Caseicin C | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1765 | 26616950;16517684 | NA | NA | SDIPNPIGSENSEK | SDIPNPIGSENSEK | 14 | Casein (Heat treated Milk with closed vials) | Caseicin C | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1766 | 26616950;16517684 | NA | NA | SDIPNPIGSENSEK | SDIPNPIGSENSEK | 14 | Casein (Kefir) | Caseicin C | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1767 | 26616950;1471476 | NA | NA | YPVEPFTE | YPVEPFTE | 8 | Casein (raw Milk) | Casohypotensin | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1768 | 26616950;1471476 | NA | NA | YPVEPFTE | YPVEPFTE | 8 | Casein (Heat treated Milk with open vials) | Casohypotensin | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1769 | 26616950;1471476 | NA | NA | YPVEPFTE | YPVEPFTE | 8 | Casein (Heat treated Milk with closed vials) | Casohypotensin | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1770 | 26616950;1471476 | NA | NA | YPVEPFTE | YPVEPFTE | 8 | Casein (Kefir) | Casohypotensin | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1771 | 26616950;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1772 | 26616950;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1773 | 26616950;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1774 | 26616950;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1775 | 26616950;10503774 | NA | NA | YPVEPF | YPVEPF | 6 | Casein (Kefir) | b-Neocasomorphin-6 | NA | 23 C and then at 4c | 24 h +24h | Opioid | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1776 | 26616950;10503774 | NA | NA | YPVEPF | YPVEPF | 6 | Casein (raw Milk) | b-Neocasomorphin-6 | NA | 23 C and then at 4c | 24 h +24h | Opioid | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1777 | 26616950;3732274 | NA | NA | MAIPPKKNQDK | MAIPPKKNQDK | 11 | Casein (Kefir) | Casoplatelin | NA | 23 C and then at 4c | 24 h +24h | Antithrombotic | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1778 | 26616950 | NA | NA | YPSYGLN | YPSYGLN | 7 | Casein (Kefir) | Casoxin-A | NA | 23 C and then at 4c | 24 h +24h | Opioid antagonist | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1779 | 26616950;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Casein (Heat treated Milk with open vials) | Isracidin | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1780 | 26616950;10503774 | NA | NA | YPFPGPIPN | YPFPGPIPN | 9 | Casein (Kefir) | Pro-8-b-casomorphin 9 | NA | 23 C and then at 4c | 24 h +24h | Opioid | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1781 | 26616950;10503774 | NA | NA | YPFPGPIPNSLPQ | YPFPGPIPNSLPQ | 13 | Casein (Kefir) | Pro-8-b-casomorphin-13 | NA | 23 C and then at 4c | 24 h +24h | Opioid | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1782 | 26616950 | NA | NA | VYPFPGPIPN | VYPFPGPIPN | 10 | Casein (Kefir) | V-b-casomorphin-9 | NA | 23 C and then at 4c | 24 h +24h | Antioxidant | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1783 | 26616950;16517684 | NA | NA | PGPIPN | PGPIPN | 6 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-microbial | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1784 | 26616950;17483270 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1785 | 26616950; 17483270 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1786 | 26616950; 17483271 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1787 | 26616950; 17483272 | NA | NA | VLNENLLR | VLNENLLR | 8 | Casein (Kefir) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1788 | 26616950; 17483273 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1789 | 26616950; 17483274 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1790 | 26616950; 17483275 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1791 | 26616950; 17483276 | NA | NA | SQSKVLPVPQ | SQSKVLPVPQ | 10 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1792 | 26616950; 17483277 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1793 | 26616950; 17483278 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1794 | 26616950; 17483279 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1795 | 26616950; 17483280 | NA | NA | MPFPKYPVEP | MPFPKYPVEP | 10 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1796 | 26616950; 17483281 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1797 | 26616950; 17483282 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1798 | 26616950; 17483283 | NA | NA | IGSENSEKTTMP | IGSENSEKTTMP | 12 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1799 | 26616950 | NA | NA | PGPIPN | PGPIPN | 6 | Casein (Kefir) | β-Casein | NA | 24 C and then at 4c | 25 h +24h | Immunomodulatory | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1800 | 26616950;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Immunomodulatory | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1801 | 26616950;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Immunomodulatory | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1802 | 26616950;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Immunomodulatory | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1803 | 26616950;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Immunomodulatory | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1804 | 26616950;10966406 | NA | NA | NIPPLTQTPV | NIPPLTQTPV | 10 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1805 | 26616950;10966406 | NA | NA | NIPPLTQTPV | NIPPLTQTPV | 10 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1806 | 26616950;10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Casein (raw Milk) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1807 | 26616950;10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Casein (Heat treated Milk with open vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1808 | 26616950;10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Casein (Heat treated Milk with closed vials) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1809 | 26616950;10966406 | NA | NA | DKIHPF | DKIHPF | 6 | Casein (Kefir) | β-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1810 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1811 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1812 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1813 | 26616950 | NA | NA | VAPFPEVF | VAPFPEVF | 8 | Casein (Kefir) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1814 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (raw Milk) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1815 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (Heat treated Milk with open vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1816 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (Heat treated Milk with closed vials) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | NA | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1817 | 26616950 | NA | NA | FVAPFPEV | FVAPFPEV | 8 | Casein (Kefir) | αS1-Casein | NA | 23 C and then at 4c | 24 h +24h | Anti-hypertensive | NA | NA | NA | Kefir grains(Lactobacillus,Lactococcus, Leuconostoc ,Streptococcus Saccharomyces, Candida, Kluyveromyces, Debaryomyces and Torulaspora) | Proteases | LC-MS with Q Exactive Plus hybridquadrupole-Orbitrap mass spectrometer | NA | NA | NA |
| FMDB1820 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FVAPFPE | FVAPFPE | 7 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 806.388+1 | 805.372 | NA |
| FMDB1821 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VAPFP | VAPFP | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 530.179+1 | 529.172 | NA |
| FMDB1822 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VAPFPE | VAPFPE | 6 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 659.312+1 | 658.304 | NA |
| FMDB1823 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FGKEK | FGKEK | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 608.373+1 | 607.366 | NA |
| FMDB1824 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | EKVNE | EKVNE | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 618.394+1 | 617.387 | NA |
| FMDB1825 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IQKED | IQKED | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 632.362+1 | 631.354 | NA |
| FMDB1826 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LEQL | LEQL | 4 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 502.15+1 | 501.143 | NA |
| FMDB1827 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IHAQ | IHAQ | 4 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 468.196+1 | 467.189 | NA |
| FMDB1828 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VNQEL | VNQEL | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 602.321+1 | 601.313 | NA |
| FMDB1829 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | YPSGAW | YPSGAW | 6 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 680.309+1 | 679.302 | NA |
| FMDB1830 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | PSGAW | PSGAW | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 517.184+1 | 516.177 | NA |
| FMDB1831 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VPLGTQY | VPLGTQY | 7 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 777.435+1 | 776.428 | NA |
| FMDB1832 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LGTQY | LGTQY | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 581.257+1 | 580.25 | NA |
| FMDB1833 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | DIPNP | DIPNP | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 555.344+1 | 554.337 | NA |
| FMDB1834 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IGSEN | IGSEN | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 519.164+1 | 518.156 | NA |
| FMDB1835 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | MEHVS | MEHVS | 5 | Casein ( proMilk 85) | αS2-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 602.321+1 | 601.313 | NA |
| FMDB1836 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | YQGPIVLNP | YQGPIVLNP | 9 | Casein ( proMilk 85) | αS2-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 1000.532+1 | 999.525 | NA |
| FMDB1837 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | QGPIVLNP | QGPIVLNP | 8 | Casein ( proMilk 85) | αS2-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 837.459+1 | 836.452 | NA |
| FMDB1838 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | AVPITPT | AVPITPT | 7 | Casein ( proMilk 85) | αS2-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 698.394+1 | 697.386 | NA |
| FMDB1839 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | PITPT | PITPT | 5 | Casein ( proMilk 85) | αS2-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 528.248+1 | 527.24 | NA |
| FMDB1840 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | TKVIPY | TKVIPY | 6 | Casein ( proMilk 85) | αS2-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | intracellular protease | RP-HPLC-MS/MS | 720.417+1 | 719.409 | NA |
| FMDB1841 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LNVPGE | LNVPGE | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 628.27+1 | 627.263 | NA |
| FMDB1842 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | QQQTED | QQQTED | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 748.265+1 | 747.258 | NA |
| FMDB1843 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VYPFP | VYPFP | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 622.309+1 | 621.302 | NA |
| FMDB1844 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IPPL | IPPL | 4 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 439.026+1 | 438.018 | NA |
| FMDB1845 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IPPLTQ | IPPLTQ | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 668.38+1 | 667.373 | NA |
| FMDB1846 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | KYPVEP | KYPVEP | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 732.347+1 | 731.34 | NA |
| FMDB1847 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LTDVEN | LTDVEN | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 690.282+1 | 689.275 | NA |
| FMDB1848 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | TDVEN | TDVEN | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 577.164+1 | 576.157 | NA |
| FMDB1849 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LHLPLP | LHLPLP | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 689.449+1 | 688.442 | 425 ± 44 uM |
| FMDB1850 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | HLPLP | HLPLP | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 576.304+1 | 575.297 | NA |
| FMDB1851 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | MHQPH | MHQPH | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 649.265+1 | 648.258 | NA |
| FMDB1852 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VMFPPQS | VMFPPQS | 7 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 805.351+1 | 804.343 | NA |
| FMDB1853 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VLPVPQK | VLPVPQK | 7 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 780.457+1 | 779.45 | NA |
| FMDB1854 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | YQEP | YQEP | 4 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 536.148+1 | 535.14 | NA |
| FMDB1855 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IPIQY | IPIQY | 5 | Casein ( proMilk 85) | k-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 633.35+1 | 632.343 | NA |
| FMDB1856 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | YQQKP | YQQKP | 5 | Casein ( proMilk 85) | k-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH1 | cell-envelope proteinase | RP-HPLC-MS/MS | 663.318+1 | 662.311 | NA |
| FMDB1857 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FVAPFPE | FVAPFPE | 7 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 805.399+1 | 805.378 | NA |
| FMDB1858 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | PEVFGK | PEVFGK | 6 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 676.407 | 675.4 | NA |
| FMDB1859 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VFGKEK | VFGKEK | 6 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 707.446 | 706.439 | NA |
| FMDB1860 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | MEDIKQ | MEDIKQ | 6 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 763.321 | 762.322 | NA |
| FMDB1861 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | EDIKQ | EDIKQ | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 732.394 | 631.328 | NA |
| FMDB1862 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | MIGVNQEL | MIGVNQEL | 8 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 903.472 | 902.465 | NA |
| FMDB1863 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | PSGAW | PSGAW | 5 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 517.171 | 516.164 | NA |
| FMDB1864 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FSDIPNP | FSDIPNP | 7 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 789.371 | 788.634 | NA |
| FMDB1865 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | NPIGSEN | NPIGSEN | 7 | Casein ( proMilk 85) | αS1-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | intracellular protease | RP-HPLC-MS/MS | 730.385 | 729.314 | NA |
| FMDB1866 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | RELEE | RELEE | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 675.257 | 674.322 | NA |
| FMDB1867 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LNVPGE | LNVPGE | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 649.284 | 627.306 | NA |
| FMDB1868 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | QQQTE | QQQTE | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 633.295 | 632.288 | NA |
| FMDB1869 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | QQQTED | QQQTED | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 748.284 | 747.277 | NA |
| FMDB1870 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | QQQTEDE | QQQTEDE | 7 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 875.371 | 876.305 | NA |
| FMDB1871 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | ELQDK | ELQDK | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 632.355 | 631.335 | NA |
| FMDB1872 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FAQTQS | FAQTQS | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 681.303 | 680.296 | NA |
| FMDB1873 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VYPFP | VYPFP | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 622.309 | 621.302 | 5.2 ± 0.3 uM |
| FMDB1874 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IPPLTQ | IPPLTQ | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 668.416 | 667.409 | NA |
| FMDB1875 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IPPLTQT | IPPLTQT | 7 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 769.342 | 768.386 | NA |
| FMDB1876 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IPPLTQTP | IPPLTQTP | 8 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 866.472 | 865.465 | NA |
| FMDB1877 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | PPLTQTP | PPLTQTP | 7 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 753.385 | 752.378 | NA |
| FMDB1878 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VSKVKE | VSKVKE | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 689.313 | 688.395 | NA |
| FMDB1879 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VSKVKEA | VSKVKEA | 7 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 760.456 | 759.449 | NA |
| FMDB1880 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VKEAM | VKEAM | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 577.327 | 576.267 | NA |
| FMDB1881 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FPKYP | FPKYP | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 651.384 | 650.376 | NA |
| FMDB1882 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | KYPVEP | KYPVEP | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 732.274 | 731.364 | NA |
| FMDB1883 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FTESQ | FTESQ | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 611.329 | 610.267 | NA |
| FMDB1884 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | FTESQS | FTESQS | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 698.269 | 697.262 | NA |
| FMDB1885 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LTLTDVEN | LTLTDVEN | 8 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 904.446 | 903.439 | NA |
| FMDB1886 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LHLPLP | LHLPLP | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 689.313 | 688.392 | NA |
| FMDB1887 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LHLPLPL | LHLPLPL | 7 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 802.505 | 801.498 | 425 ± 44 uM |
| FMDB1888 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LHLPLPLLQS | LHLPLPLLQS | 10 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 1130.667 | 1129.66 | NA |
| FMDB1889 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | HLPLP | HLPLP | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 576.334 | 575.327 | NA |
| FMDB1890 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LPLPLLQ | LPLPLLQ | 7 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 793.521 | 792.514 | NA |
| FMDB1891 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LPLPLLQS | LPLPLLQS | 8 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 880.515 | 879.508 | NA |
| FMDB1892 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LPLLQS | LPLLQS | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 670.42 | 669.413 | NA |
| FMDB1893 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LQSW | LQSW | 4 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 533.184 | 532.177 | NA |
| FMDB1894 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | MHQPH | MHQPH | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 649.329 | 648.277 | NA |
| FMDB1895 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | VMFPPQS | VMFPPQS | 7 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 805.402 | 804.348 | NA |
| FMDB1896 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | SLSQSK | SLSQSK | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 649.327 | 648.32 | NA |
| FMDB1897 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | SKVLP | SKVLP | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 543.27 | 542.262 | NA |
| FMDB1898 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | MPIQA | MPIQA | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 559.253 | 558.246 | NA |
| FMDB1899 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LLYQEP | LLYQEP | 6 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 762.385 | 761.378 | NA |
| FMDB1900 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | LYQEP | LYQEP | 5 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 649.318 | 648.31 | NA |
| FMDB1901 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | GPVRGPFP | GPVRGPFP | 8 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 826.445 | 825.438 | NA |
| FMDB1902 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | GPVRGPFPI | GPVRGPFPI | 9 | Casein ( proMilk 85) | β-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 939.5 | 938.493 | NA |
| FMDB1903 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | IPTINT | IPTINT | 6 | Casein ( proMilk 85) | k-Casein | NA | 28C | 6days | NA | NA | NA | NA | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 658.37 | 657.363 | NA |
| FMDB1904 | NA | tejedor15 | Dairy Debaryomyces hansenii strains produce the antihypertensive Casein-derived peptides LHLPLP and HLPLP | SPPEINT | SPPEINT | 7 | Casein ( proMilk 85) | k-Casein | NA | 28C | 6days | Ace-inhibitory | In vitro | NA | Fluorescent assay using o-aminobenzoyl-Gly-p-nitro-Phe-Pro as substarte | Debaryomyces hansenii DH14 | cell-envelope proteinase | RP-HPLC-MS/MS | 757.362 | 756.355 | NA |
| FMDB1905 | NA | tsai08 | Antihypertensive effect of bioactive peptides produced by protease-facilitated lactic acid fermentation of Milk | YPYY | YPYY | 4 | Fermented Milk Whey product (4.5% (w/v) skimmed Milk powder, 5.5% (w/v) whole Milk powder and 7% (w/v) sucrose ) | Casein | NA | 43c | 5h | Ace-inhibitory | In vitro | NA | RP-HPLC modified spectrophotometric assay using HHL as substrate | Streptococcus thermophilus and Lactobacillus bulgaricus + . Flavourzyme from Aspergillus oryzae | protease | RP-HPLC and protein sequencer 492 Procise | NA | NA | 90.9uM |
| FMDB1906 | NA | tsai08 | Antihypertensive effect of bioactive peptides produced by protease-facilitated lactic acid fermentation of Milk | YPYY | YPYY | 4 | Fermented Milk Whey product (4.5% (w/v) skimmed Milk powder, 5.5% (w/v) whole Milk powder and 7% (w/v) sucrose ) | Casein | NA | 43c | 5h | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | Streptococcus thermophilus and Lactobacillus bulgaricus + . Flavourzyme from Aspergillus oryzae | protease | RP-HPLC and protein sequencer 492 Procise | NA | NA | 90.9uM |
| FMDB1907 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1908 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1909 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1910 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1911 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1912 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1913 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1914 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1915 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1916 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1917 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1918 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1919 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1920 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1921 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1922 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1923 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1924 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1925 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1926 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1927 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1928 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1929 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1930 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1931 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1932 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1933 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1934 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1935 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1936 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1937 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1938 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1939 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1940 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1941 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1942 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1943 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1944 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1945 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1946 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1947 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1948 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1949 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1950 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1951 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1952 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1953 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1954 | 22098174 | NA | NA | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 59 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1955 | 22098174 | NA | NA | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 40 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1956 | 22098174 | NA | NA | KMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | KMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 42 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1957 | 22098174 | NA | NA | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 40 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1958 | 22098174 | NA | NA | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 59 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1959 | 22098174 | NA | NA | KMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | KMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 42 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1960 | 22098174 | NA | NA | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 40 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1961 | 22098174 | NA | NA | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 59 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1962 | 22098174 | NA | NA | KMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | KMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 42 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1963 | 22098174 | NA | NA | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 40 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1964 | 22098174 | NA | NA | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 59 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1965 | 22098174 | NA | NA | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 40 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1972 | 19619856 | NA | NA | IPP | IPP | 3 | Casein miso paste (sodium Caseinate (24%: w/w), rice koji (20.9%: w/w), salt (10.8%: w/w), S.cerevisiae (0.1%: w/w) and water (3.1%: w/w) | Casein | NA | 30c | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | A.oryzae in rice koji +Saccharomyces cerevisiae | proteinase and peptidase | LC-MS | NA | NA | NA |
| FMDB1973 | 19619856 | NA | NA | VPP | VPP | 3 | Casein miso paste (sodium Caseinate (24%: w/w), rice koji (20.9%: w/w), salt (10.8%: w/w), S.cerevisiae (0.1%: w/w) and water (3.1%: w/w) | Casein | NA | 30c | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | A.oryzae in rice koji +Saccharomyces cerevisiae | proteinase and peptidase | LC-MS | NA | NA | NA |
| FMDB1974 | 19619856 | NA | NA | IPP | IPP | 3 | Casein miso paste (sodium Caseinate (24%: w/w), rice koji (20.9%: w/w), salt (10.8%: w/w), S.cerevisiae (0.1%: w/w) and water (3.1%: w/w) | Casein | NA | 30c | 7days | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | A.oryzae in rice koji +Saccharomyces cerevisiae | proteinase and peptidase | LC-MS | NA | NA | NA |
| FMDB1975 | 19619856 | NA | NA | VPP | VPP | 3 | Casein miso paste (sodium Caseinate (24%: w/w), rice koji (20.9%: w/w), salt (10.8%: w/w), S.cerevisiae (0.1%: w/w) and water (3.1%: w/w) | Casein | NA | 30c | 7days | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | A.oryzae in rice koji +Saccharomyces cerevisiae | proteinase and peptidase | LC-MS | NA | NA | NA |
| FMDB1976 | 12843654 | NA | NA | IFL | IFL | 3 | Tofuyo | Alpha &beta subunit of beta con Glycinin ( 476-478) & ( 247-249) | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | A.oryzae or/M.purpureus | proteases | automated Edman degardation with a gas/liquid phase protein sequencer | NA | NA | 44.8uM |
| FMDB1977 | 12843654 | NA | NA | WL | WL | 2 | Tofuyo | B-B1A-&BX subunit of Glycinin ( 44-45) and (43-44) | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | A.oryzae or/M.purpureus | proteases | automated Edman degardation with a gas/liquid phase protein sequencer | NA | NA | 29.9uM |
| FMDB1980 | 12358510 | NA | NA | VY | VY | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 35.2uM |
| FMDB1981 | 12358510 | NA | NA | IY | IY | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 6.1uM |
| FMDB1982 | 12358510 | NA | NA | AW | AW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 18.8uM |
| FMDB1983 | 12358510 | NA | NA | FY | FY | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 42.3uM |
| FMDB1984 | 12358510 | NA | NA | VW | VW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 3.3uM |
| FMDB1985 | 12358510 | NA | NA | IW | IW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 1.5uM |
| FMDB1986 | 12358510 | NA | NA | LW | LW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 23.6uM |
| FMDB1987 | 12358510 | NA | NA | VY | VY | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 35.2uM |
| FMDB1988 | 12358510 | NA | NA | IY | IY | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 6.1uM |
| FMDB1989 | 12358510 | NA | NA | AW | AW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 18.8uM |
| FMDB1990 | 12358510 | NA | NA | FY | FY | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 42.3uM |
| FMDB1991 | 12358510 | NA | NA | VW | VW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 3.3uM |
| FMDB1992 | 12358510 | NA | NA | IW | IW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 1.5uM |
| FMDB1993 | 12358510 | NA | NA | LW | LW | 2 | Wakame Hydrolysates | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | “Amano” (from Bacillus stearothermophilus) | Protease S | LC-MS | NA | NA | 23.6uM |
| FMDB2003 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 7.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60208 or H9) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2004 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 7.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60208 or H9) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2005 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30046) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2006 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30046) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2007 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 34.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60205) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2008 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 32.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU10142) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2009 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 32.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU10142) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2010 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 15.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30005) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2011 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 15.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30005) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2012 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60207) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2013 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60207) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2014 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60210) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2015 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60210) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2016 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60211) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2017 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.3h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60211) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2018 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60204) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2019 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60204) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2020 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50010) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2021 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60201) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2022 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 12.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60201) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2023 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 24.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60220) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2024 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60066) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2025 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 10.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60066) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2026 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.2h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60212) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2027 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.2h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60212) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2028 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50151) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2029 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50151) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2030 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60117) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2031 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11.7h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60117) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2032 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30003) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2033 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 11h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30003) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2034 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 23h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30023) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2035 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 42.4h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50061) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2036 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30134) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2037 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 16h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU30134) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2038 | 25151888;12369200 | NA | NA | VPP | VPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 14.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60206) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 9 micro mol /l |
| FMDB2039 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 14.5h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU60206) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2040 | 25151888;12369200 | NA | NA | IPP | IPP | 3 | Fermented Milk | Casein | 4.5 | 37c | 25.0h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substate | L. helveticus (IMAU50011) | extracellular proteinase | Ultra Performance LC-Tandem MS | NA | NA | 5 micromol/l |
| FMDB2046 | 24175632;23742096 | NA | NA | pyro ENIDNP | pyro ENIDNP | 11 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis;colitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 683.4 | NA |
| FMDB2047 | 24175632;23742096 | NA | NA | pyroENI | pyroENI | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 357.1 | NA |
| FMDB2048 | 24175632;23742096 | NA | NA | pyroEV | pyroEV | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 229.1 | NA |
| FMDB2049 | 24175632;23742096 | NA | NA | pyroELW | pyroELW | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 428.9 | NA |
| FMDB2050 | 24175632;23742096 | NA | NA | pyroEVA | pyroEVA | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 299.9 | NA |
| FMDB2051 | 24175632;23742096 | NA | NA | pyroEVP | pyroEVP | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 325.9 | NA |
| FMDB2052 | 24175632;23742096 | NA | NA | pyroEVV | pyroEVV | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 328 | NA |
| FMDB2053 | 24175632;23742096 | NA | NA | pyroENF | pyroENF | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 390.9 | NA |
| FMDB2054 | 24175632;23742096 | NA | NA | pyroEL | pyroEL | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 243 | NA |
| FMDB2055 | 24175632;23742096 | NA | NA | pyroEQ | pyroEQ | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 258.1 | NA |
| FMDB2056 | 24175632;23742096 | NA | NA | pyroESQ | pyroESQ | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 345.1 | NA |
| FMDB2057 | 24175632;23742096 | NA | NA | pyroEM | pyroEM | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 260.9 | NA |
| FMDB2058 | 24175632;23742096 | NA | NA | pyroEGQ | pyroEGQ | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 314.9 | NA |
| FMDB2059 | 24175632;23742096 | NA | NA | pyroEY | pyroEY | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 293 | NA |
| FMDB2060 | 24175632;23742096 | NA | NA | pyroEF | pyroEF | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 276.9 | NA |
| FMDB2061 | 24175632;23742096 | NA | NA | pyroEN | pyroEN | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 244.2 | NA |
| FMDB2062 | 24175632;23742096 | NA | NA | pyroES | pyroES | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 216.9 | NA |
| FMDB2063 | 24175632;23742096 | NA | NA | pyroEG | pyroEG | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 187.1 | NA |
| FMDB2064 | 24175632;23742096 | NA | NA | pyroGA | pyroGA | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 200.9 | NA |
| FMDB2065 | 12957917 | NA | NA | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Bovine Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2100.28 | 57.2ug/ml |
| FMDB2066 | 12957917 | NA | NA | FVAPFPEVFGKEKVNELSKDIGSE | FVAPFPEVFGKEKVNELSKDIGSE | 24 | Bovine Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2194.35 | 57.2ug/ml |
| FMDB2067 | 12957917 | NA | NA | LGTQYTDAPSFSDIPNPIGSENSEK | LGTQYTDAPSFSDIPNPIGSENSEK | 25 | Bovine Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2122.27 | 57.2ug/ml |
| FMDB2068 | 12957917 | NA | NA | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Bovine Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2100.28 | 16.2ug/ml |
| FMDB2069 | 12957917 | NA | NA | FVAPFPEVFGKEKVNELSKDIGSE | FVAPFPEVFGKEKVNELSKDIGSE | 24 | Bovine Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2194.35 | 16.2ug/ml |
| FMDB2070 | 12957917 | NA | NA | LVYPFPGPIPNSLPQNIPP | LVYPFPGPIPNSLPQNIPP | 19 | Bovine Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 2100.28 | 23.9ug/ml |
| FMDB2071 | 12957917 | NA | NA | RPKHPI | RPKHPI | 6 | sheep Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 746.9 | 120.2ug/ml |
| FMDB2072 | 12957917 | NA | NA | RPKH | RPKH | 4 | sheep Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 537.32 | 120.2ug/ml |
| FMDB2073 | 12957917 | NA | NA | HPIKH | HPIKH | 5 | sheep Milk sodium Caseinate | αS1-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 631.37 | 120.2ug/ml |
| FMDB2074 | 12957917 | NA | NA | TVDQ | TVDQ | 4 | sheep Milk sodium Caseinate | αS2-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 599.42 | 786ug/ml |
| FMDB2075 | 12957917 | NA | NA | HQK | HQK | 3 | sheep Milk sodium Caseinate | αS2-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 411.46 | 786ug/ml |
| FMDB2076 | 12957917 | NA | NA | LVYPFPGP | LVYPFPGP | 8 | goat Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 888.47 | 147.3ug/ml |
| FMDB2077 | 12957917 | NA | NA | TVDQHQ | TVDQHQ | 6 | goat Milk sodium Caseinate | αS2-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 727.33 | 210.5ug/ml |
| FMDB2078 | 12957917 | NA | NA | LVYPFPGPI | LVYPFPGPI | 9 | Buffalo Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 1002.14 | 112.6ug/ml |
| FMDB2079 | 12957917 | NA | NA | QPQ | QPQ | 3 | Human Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 371.26 | 228.1ug/ml |
| FMDB2080 | 12957917 | NA | NA | VPQ | VPQ | 3 | Human Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 342.26 | 228.1ug/ml |
| FMDB2081 | 12957917 | NA | NA | IPQ | IPQ | 3 | Human Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL and furanacryloyl-Phe-Gly-Gly as substate | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 356.36 | 228.1ug/ml |
| FMDB2082 | 12957917 | NA | NA | QELLLNPTHQYPVTQPLAPVHNPISV | QELLLNPTHQYPVTQPLAPVHNPISV | 26 | Human Milk sodium Caseinate | β-Casein | 4.6 | 37c | 48h | Antibacterial against Enterococcus faecium;Bacillus megaterium;Escherichia coli;Listeria innocua;Salmonella spp.;Yersinia enterocolitica;;Staphylococcus aureus | In vitro | NA | well diffusion assay | Proteinase of L.helveticus PR4 | proteinase | MALDITOF-MS | NA | 3132.8 | NA |