Welcome to Entry Card of Peptide
Details of FermFooDB_ID FMDB1909 |
Primary information | |
---|---|
FMDB_ID | FMDB1909 |
PMID | 22098174 |
Reference | NA |
Title | NA |
Peptide Sequence | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
Length | 32 |
Food_Matrix | WSE of Wholemeal wheat Flour dough |
Protein Name | NA |
pH | 4 |
Temperature | 30c |
Incubation Time | 16h |
Activity | NA |
Experiment | NA |
Model | NA |
Assay for Activity Measurement | NA |
Starter Culture | Lactobacillus curvatus SAL33 |
Hydrolysis | proteinase and peptidase |
Method of Analysis | nano-LC-ESI-MS |
M/Z ratio | NA |
Mass | NA |
IC50 | NA |