Welcome to Entry Card of Peptide
Details of FermFooDB_ID FMDB1952 |
| Primary information | |
|---|---|
| FMDB_ID | FMDB1952 |
| PMID | 22098174 |
| Reference | NA |
| Title | NA |
| Peptide Sequence | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD |
| Length | 32 |
| Food_Matrix | WSE barley Flour |
| Protein Name | NA |
| pH | 4 |
| Temperature | 30c |
| Incubation Time | 16h |
| Activity | NA |
| Experiment | NA |
| Model | NA |
| Assay for Activity Measurement | NA |
| Starter Culture | Lactobacillus plantarum 3DM |
| Hydrolysis | proteinase and peptidase |
| Method of Analysis | nano-LC-ESI-MS |
| M/Z ratio | NA |
| Mass | NA |
| IC50 | NA |