Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_1191	Bropirimine Click for more detail	NA	C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	experimental drug with anti-cancer and antiviral properties	DUOX2	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	NA	24830024	2014	Pubchem_assay
PRRID_1191	Bropirimine Click for more detail	NA	C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	experimental drug with anti-cancer and antiviral properties	DUOX2	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	NA	24830024	2014	Pubchem_assay
PRRID_1205	CL075 Click for more detail	Thiazoloquinoline compound (others)	CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	stimulates TLR8 in human peripheral blood mononuclear cells. It activates NF-Œ∫B and triggers preferentially the production of TNF-Œ± and IL-12	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	lung cancer cells	cell compartment	Q9NR97.fasta	Q9NR97	1041	binding of TLR8 to its ligand stimulated cell proliferation	MTT assay, Cell Proliferation Assay	24782650	2014	Pubchem_assay
PRRID_1205	CL075 Click for more detail	Thiazoloquinoline compound (others)	CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	stimulates TLR8 in human peripheral blood mononuclear cells. It activates NF-Œ∫B and triggers preferentially the production of TNF-Œ± and IL-12	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	lung cancer cells	cell compartment	Q9NR97.fasta	Q9NR97	1041	binding of TLR8 to its ligand stimulated cell proliferation	MTT assay, Cell Proliferation Assay	24782650	2014	Pubchem_assay
PRRID_1206	CL075 Click for more detail	Thiazoloquinoline compound (others)	CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	stimulates TLR8 in human peripheral blood mononuclear cells. It activates NF-Œ∫B and triggers preferentially the production of TNF-Œ± and IL-12	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Mice	dendritic cells, macrophages, natural killer cells	cell compartment	NA	NA	NA	important role in the immune response to viral infection	ELISA	24771328	2014	NA
PRRID_1206	CL075 Click for more detail	Thiazoloquinoline compound (others)	CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	stimulates TLR8 in human peripheral blood mononuclear cells. It activates NF-Œ∫B and triggers preferentially the production of TNF-Œ± and IL-12	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Mice	dendritic cells, macrophages, natural killer cells	cell compartment	NA	NA	NA	important role in the immune response to viral infection	ELISA	24771328	2014	NA
PRRID_1207	CL075 Click for more detail	Thiazoloquinoline compound (others)	CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	stimulates TLR8 in human peripheral blood mononuclear cells. It activates NF-Œ∫B and triggers preferentially the production of TNF-Œ± and IL-12	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	cell compartment	NA	NA	NA	important role in the immune response to viral infection	ELISA	24771328	2014	NA
PRRID_1207	CL075 Click for more detail	Thiazoloquinoline compound (others)	CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	stimulates TLR8 in human peripheral blood mononuclear cells. It activates NF-Œ∫B and triggers preferentially the production of TNF-Œ± and IL-12	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	cell compartment	NA	NA	NA	important role in the immune response to viral infection	ELISA	24771328	2014	NA
PRRID_1213	CpG motif Click for more detail	Bacteria	NA	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	mast cells	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	Real-time PCR	24818634	2014	Pubchem_assay
PRRID_1213	CpG motif Click for more detail	Bacteria	NA	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	mast cells	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	Real-time PCR	24818634	2014	Pubchem_assay
PRRID_1231	dextran sodium sulphate and radiation Click for more detail	NA	CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	control intestinal epithelial homeostasis and provide protection from injury	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs	cell surface	Q9QUN7.fasta	Q9QUN7	784	NA	reverse transcription‚Äìpolymerase chain reaction (RT‚ÄìPCR), real-time RT‚ÄìPCR, flow cytometry, immunocytochemistry and Western blot analysis.	24828022	2014	Pubchem_assay
PRRID_1231	dextran sodium sulphate and radiation Click for more detail	NA	CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	control intestinal epithelial homeostasis and provide protection from injury	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs	cell surface	Q9QUN7.fasta	Q9QUN7	784	NA	reverse transcription‚Äìpolymerase chain reaction (RT‚ÄìPCR), real-time RT‚ÄìPCR, flow cytometry, immunocytochemistry and Western blot analysis.	24828022	2014	Pubchem_assay
PRRID_1232	dextran sodium sulphate and radiation Click for more detail	NA	CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	control intestinal epithelial homeostasis and provide protection from injury	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs	cell surface	Q9QUK6.fasta	Q9QUK6	835	NA	reverse transcription‚Äìpolymerase chain reaction (RT‚ÄìPCR), real-time RT‚ÄìPCR, flow cytometry, immunocytochemistry and Western blot analysis.	24828022	2014	Pubchem_assay
PRRID_1232	dextran sodium sulphate and radiation Click for more detail	NA	CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	control intestinal epithelial homeostasis and provide protection from injury	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs	cell surface	Q9QUK6.fasta	Q9QUK6	835	NA	reverse transcription‚Äìpolymerase chain reaction (RT‚ÄìPCR), real-time RT‚ÄìPCR, flow cytometry, immunocytochemistry and Western blot analysis.	24828022	2014	Pubchem_assay
PRRID_1233	dextran sodium sulphate and radiation Click for more detail	NA	CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	control intestinal epithelial homeostasis and provide protection from injury	Toll-like receptor 5 (TLR5)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs	cell surface	Q9JLF7.fasta	Q9JLF7	859	NA	reverse transcription‚Äìpolymerase chain reaction (RT‚ÄìPCR), real-time RT‚ÄìPCR, flow cytometry, immunocytochemistry and Western blot analysis.	24828022	2014	Pubchem_assay
PRRID_1233	dextran sodium sulphate and radiation Click for more detail	NA	CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	control intestinal epithelial homeostasis and provide protection from injury	Toll-like receptor 5 (TLR5)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs	cell surface	Q9JLF7.fasta	Q9JLF7	859	NA	reverse transcription‚Äìpolymerase chain reaction (RT‚ÄìPCR), real-time RT‚ÄìPCR, flow cytometry, immunocytochemistry and Western blot analysis.	24828022	2014	Pubchem_assay
PRRID_1236	Diacylated Lipopeptide Click for more detail	Mycoplasma (Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	elicit innate immune response	Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, mast cells and B-lymphocytes	cell surface	Q9EPW9.fasta	Q9EPW9	795	significant role in the pathogenesis of severe inflammatory responses	NA	24807166	2014	Pubchem_assay
PRRID_1236	Diacylated Lipopeptide Click for more detail	Mycoplasma (Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	elicit innate immune response	Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, mast cells and B-lymphocytes	cell surface	Q9EPW9.fasta	Q9EPW9	795	significant role in the pathogenesis of severe inflammatory responses	NA	24807166	2014	Pubchem_assay
PRRID_1237	Diacylated Lipopeptide Click for more detail	Mycoplasma (Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	elicit innate immune response	Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	monocyte/macrophages, mast cells and B-lymphocytes	cell surface	Q9Y2C9.fasta	Q9Y2C9	796	significant role in the pathogenesis of severe inflammatory responses	NA	24807166	2014	Pubchem_assay
PRRID_1237	Diacylated Lipopeptide Click for more detail	Mycoplasma (Bacteria)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	elicit innate immune response	Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	monocyte/macrophages, mast cells and B-lymphocytes	cell surface	Q9Y2C9.fasta	Q9Y2C9	796	significant role in the pathogenesis of severe inflammatory responses	NA	24807166	2014	Pubchem_assay
PRRID_1268	fetuin A (Fet-A) Click for more detail	Fetal bovine serum (others)	MKSFVLLFCLAQLWGCHSIPLDPVAGYKEPACDDPDTEQAALAAVDYINKHLPRGYKHTLNQIDSVKVWPRRPTGEVYDIEIDTLETTCHVLDPTPLANCSVRQQTQHAVEGDCDIHVLKQDGQFSVLFTKCDSSPDSAEDVRKLCPDCPLLAPLNDSRVVHAVEVALATFNAESNGSYLQLVEISRAQFVPLPVSVSVEFAVAATDCIAKEVVDPTKCNLLAEKQYGFCKGSVIQKALGGEDVRVTCTLFQTQPVIPQPQPDGAEAEAPSAVPDAAGPTPSAAGPPVASVVVGPSVVAVPLPLHRAHYDLRHTFSGVASVESSSGEAFHVGKTPIVGQPSIPGGPVRLCPGRIRYFKI	359	Pattern-associated molecular patterns (PAMPs)	Natural	associated with atherosclerosis.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	24823872	2014	Pubchem_assay
PRRID_1268	fetuin A (Fet-A) Click for more detail	Fetal bovine serum (others)	MKSFVLLFCLAQLWGCHSIPLDPVAGYKEPACDDPDTEQAALAAVDYINKHLPRGYKHTLNQIDSVKVWPRRPTGEVYDIEIDTLETTCHVLDPTPLANCSVRQQTQHAVEGDCDIHVLKQDGQFSVLFTKCDSSPDSAEDVRKLCPDCPLLAPLNDSRVVHAVEVALATFNAESNGSYLQLVEISRAQFVPLPVSVSVEFAVAATDCIAKEVVDPTKCNLLAEKQYGFCKGSVIQKALGGEDVRVTCTLFQTQPVIPQPQPDGAEAEAPSAVPDAAGPTPSAAGPPVASVVVGPSVVAVPLPLHRAHYDLRHTFSGVASVESSSGEAFHVGKTPIVGQPSIPGGPVRLCPGRIRYFKI	359	Pattern-associated molecular patterns (PAMPs)	Natural	associated with atherosclerosis.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	24823872	2014	Pubchem_assay
PRRID_1304	GLA( Glucopyranosyl lipid adjuvant) Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Spleen cells	cell surface	Q9QUK6.fasta	Q9QUK6	835	plays a fundamental role in pathogen recognition and activation of innate immunity	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1304	GLA( Glucopyranosyl lipid adjuvant) Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Spleen cells	cell surface	Q9QUK6.fasta	Q9QUK6	835	plays a fundamental role in pathogen recognition and activation of innate immunity	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1305	GLA( Glucopyranosyl lipid adjuvant) Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Spleen cells	cell surface	O00206.fasta	O00206	839	plays a fundamental role in pathogen recognition and activation of innate immunity	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1305	GLA( Glucopyranosyl lipid adjuvant) Click for more detail	NA	NA	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Spleen cells	cell surface	O00206.fasta	O00206	839	plays a fundamental role in pathogen recognition and activation of innate immunity	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1326	Heparan sulfate Click for more detail	pulmonary vascular cells (e.g., endothelial cells) (others)	COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	released in responses to local stresses (hypoxia or inflammation)	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human Platelets	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	Leucine-rich Repeat (LRR) Domain	Q7L0X0.fasta	Q7L0X0	811	TLR4 is expressed on platelets which mediates inflammatory and immune responses in a variety of diseases including PAH (pulmonary arterial hypertension)	NA	24812346	2014	Pubchem_assay
PRRID_1326	Heparan sulfate Click for more detail	pulmonary vascular cells (e.g., endothelial cells) (others)	COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	released in responses to local stresses (hypoxia or inflammation)	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human Platelets	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	Leucine-rich Repeat (LRR) Domain	Q7L0X0.fasta	Q7L0X0	811	TLR4 is expressed on platelets which mediates inflammatory and immune responses in a variety of diseases including PAH (pulmonary arterial hypertension)	NA	24812346	2014	Pubchem_assay
PRRID_1327	Heparan sulfate Click for more detail	Host (Endogenous) (others)	COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	induce the maturation of DCs	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	cell surface	Q9QUK6.fasta	Q9QUK6	835	Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1327	Heparan sulfate Click for more detail	Host (Endogenous) (others)	COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	induce the maturation of DCs	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	cell surface	Q9QUK6.fasta	Q9QUK6	835	Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1328	Heparan sulfate Click for more detail	Host (Endogenous) (others)	COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	induce the maturation of DCs	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	cell surface	O00206.fasta	O00206	839	Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1328	Heparan sulfate Click for more detail	Host (Endogenous) (others)	COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	induce the maturation of DCs	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	cell surface	O00206.fasta	O00206	839	Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1364	iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail	Gram-negative and Gram-positive bacteria	N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	activate NF-Œ∫B	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	European and African Children	signals via a caspase- activated recruitment domain (CARD)	signals via a caspase- activated recruitment domain (CARD)	Q9Y239.fasta	Q9Y239	953	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24743542	2014	Pubchem_assay
PRRID_1364	iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail	Gram-negative and Gram-positive bacteria	N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	activate NF-Œ∫B	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	European and African Children	signals via a caspase- activated recruitment domain (CARD)	signals via a caspase- activated recruitment domain (CARD)	Q9Y239.fasta	Q9Y239	953	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24743542	2014	Pubchem_assay
PRRID_1365	IL-2 and R848 Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC (Antibody forming cells)	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, mast cells	Cell Compartment/Intracellular (Endosome)	NA	NA	NA	selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC	ELISPOT assay, Proliferation assay	24828435	2014	NA
PRRID_1365	IL-2 and R848 Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC (Antibody forming cells)	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, mast cells	Cell Compartment/Intracellular (Endosome)	NA	NA	NA	selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC	ELISPOT assay, Proliferation assay	24828435	2014	NA
PRRID_1366	IL-2 and R848 Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC (Antibody forming cells)	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, mast cells	Cell Compartment/Intracellular (Endosome)	NA	NA	NA	selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC	ELISPOT assay, Proliferation assay	24828435	2014	NA
PRRID_1366	IL-2 and R848 Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC (Antibody forming cells)	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, mast cells	Cell Compartment/Intracellular (Endosome)	NA	NA	NA	selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC	ELISPOT assay, Proliferation assay	24828435	2014	NA
PRRID_1367	Imidazoquinoline Click for more detail	tricyclic organic molecule (others)	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce type I IFN, antiviral and antitumor therapeutic molecules	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	P58681.fasta	P58681	1050	important role in the immune response to viral infection	NA	24830024	2014	Pubchem_assay
PRRID_1367	Imidazoquinoline Click for more detail	tricyclic organic molecule (others)	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce type I IFN, antiviral and antitumor therapeutic molecules	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	P58681.fasta	P58681	1050	important role in the immune response to viral infection	NA	24830024	2014	Pubchem_assay
PRRID_1368	Imidazoquinoline Click for more detail	tricyclic organic molecule (others)	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce type I IFN, antiviral and antitumor therapeutic molecules	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, mast cells	Cell Compartment/Intracellular (Endosome)	P58682.fasta	P58682	1032	important role in the immune response to viral infection	NA	24830024	2014	Pubchem_assay
PRRID_1368	Imidazoquinoline Click for more detail	tricyclic organic molecule (others)	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce type I IFN, antiviral and antitumor therapeutic molecules	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, mast cells	Cell Compartment/Intracellular (Endosome)	P58682.fasta	P58682	1032	important role in the immune response to viral infection	NA	24830024	2014	Pubchem_assay
PRRID_1369	imidazoquinoline (R848 (also known as Resiquimod)) Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte-derived dendritic cells,polymorphonuclear leukocytes (PMN)	extracellular domain (ECD)	Q9NYK1.fasta	Q9NYK1	1049	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1369	imidazoquinoline (R848 (also known as Resiquimod)) Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte-derived dendritic cells,polymorphonuclear leukocytes (PMN)	extracellular domain (ECD)	Q9NYK1.fasta	Q9NYK1	1049	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1370	imidazoquinoline (R848 (also known as Resiquimod)) Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	monocyte-derived dendritic cells,polymorphonuclear leukocytes (PMN)	extracellular domain (ECD)	Q9NR97.fasta	Q9NR97	1041	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1370	imidazoquinoline (R848 (also known as Resiquimod)) Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	monocyte-derived dendritic cells,polymorphonuclear leukocytes (PMN)	extracellular domain (ECD)	Q9NR97.fasta	Q9NR97	1041	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1371	Imiquimod Click for more detail	Virus	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	mast cells	Cell Compartment/Intracellular (Endosome)	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	Real-time PCR	24818634	2014	Pubchem_assay
PRRID_1371	Imiquimod Click for more detail	Virus	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	mast cells	Cell Compartment/Intracellular (Endosome)	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	Real-time PCR	24818634	2014	Pubchem_assay
PRRID_1372	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	Spleen cells	cell compartment	P58681.fasta	P58681	1050	important role in the immune response to viral infection	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1372	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	Spleen cells	cell compartment	P58681.fasta	P58681	1050	important role in the immune response to viral infection	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1373	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Spleen cells	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1373	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Spleen cells	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1374	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	activates anti-tumor immunity	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	skin samples	NA	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	MTT assay	24743316	2014	Pubchem_assay
PRRID_1374	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	activates anti-tumor immunity	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	skin samples	NA	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	MTT assay	24743316	2014	Pubchem_assay
PRRID_1375	Imiquimod Click for more detail	imidazoquinoline amine analogue to guanosine (others)	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induced significant up-regulation of IL-1b, IL-6, IL-8, IL-10, IFN-c, IFN-a1 and Mx	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	NA	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1375	Imiquimod Click for more detail	imidazoquinoline amine analogue to guanosine (others)	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induced significant up-regulation of IL-1b, IL-6, IL-8, IL-10, IFN-c, IFN-a1 and Mx	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	NA	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1383	isomers of opioid ligands Click for more detail	opioid (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	It is primarily used for pain relief, cough and constipation	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	spinal microglia, macrophage and astrocytes	cell surface	Q9QUK6.fasta	Q9QUK6	835	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	NA	24824631	2014	Pubchem_assay
PRRID_1383	isomers of opioid ligands Click for more detail	opioid (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	It is primarily used for pain relief, cough and constipation	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	spinal microglia, macrophage and astrocytes	cell surface	Q9QUK6.fasta	Q9QUK6	835	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	NA	24824631	2014	Pubchem_assay
PRRID_1384	isomers of opioids Click for more detail	opioid (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	It is primarily used for pain relief, cough and constipation	mu opioid receptors	mu opioid receptors	Mice	central nervous system. mu opioid receptors are found on pre- and post-synaptic nociceptive neurons, as well as on astrocytes and microglia	NA	P42866.fasta	P42866	398	It is an inhibitory G-protein coupled receptor	NA	24824631	2014	Pubchem_assay
PRRID_1384	isomers of opioids Click for more detail	opioid (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	It is primarily used for pain relief, cough and constipation	mu opioid receptors	mu opioid receptors	Mice	central nervous system. mu opioid receptors are found on pre- and post-synaptic nociceptive neurons, as well as on astrocytes and microglia	NA	P42866.fasta	P42866	398	It is an inhibitory G-protein coupled receptor	NA	24824631	2014	Pubchem_assay
PRRID_1458	low molecular weight molecules of the imidazoquinoline family Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce type I IFN, antiviral and antitumor therapeutic molecules	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NYK1.fasta	Q9NYK1	1049	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1458	low molecular weight molecules of the imidazoquinoline family Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce type I IFN, antiviral and antitumor therapeutic molecules	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NYK1.fasta	Q9NYK1	1049	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1459	low molecular weight molecules of the imidazoquinoline family Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce type I IFN, antiviral and antitumor therapeutic molecules	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NR97.fasta	Q9NR97	1041	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1459	low molecular weight molecules of the imidazoquinoline family Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce type I IFN, antiviral and antitumor therapeutic molecules	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NR97.fasta	Q9NR97	1041	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1460	Loxoribine (7-allyl-7,8-dihydro-8-oxo-guanosine) Click for more detail	Guanosine (others)	C=CCN1C2=C(NC(=NC2=O)N)N(C1=O)C3C(C(C(O3)CO)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	It activates the innate immune system through Toll-like receptor 7	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	P58681.fasta	P58681	1050	important role in the immune response to viral infection	NA	24830024	2014	Pubchem_assay
PRRID_1460	Loxoribine (7-allyl-7,8-dihydro-8-oxo-guanosine) Click for more detail	Guanosine (others)	C=CCN1C2=C(NC(=NC2=O)N)N(C1=O)C3C(C(C(O3)CO)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	It activates the innate immune system through Toll-like receptor 7	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	P58681.fasta	P58681	1050	important role in the immune response to viral infection	NA	24830024	2014	Pubchem_assay
PRRID_1461	Loxoribine (7-allyl-7,8-dihydro-8-oxo-guanosine) Click for more detail	Guanosine (others)	C=CCN1C2=C(NC(=NC2=O)N)N(C1=O)C3C(C(C(O3)CO)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	It activates the innate immune system through Toll-like receptor 7	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Guinea Pig	plasmacytoid and myeloid DCs	Cell Compartment/Intracellular (Endosome)	NA	NA	NA	important role in the immune response to viral infection	Real-time RT-PCR, Calcium influx assay	24819048	2014	NA
PRRID_1461	Loxoribine (7-allyl-7,8-dihydro-8-oxo-guanosine) Click for more detail	Guanosine (others)	C=CCN1C2=C(NC(=NC2=O)N)N(C1=O)C3C(C(C(O3)CO)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	It activates the innate immune system through Toll-like receptor 7	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Guinea Pig	plasmacytoid and myeloid DCs	Cell Compartment/Intracellular (Endosome)	NA	NA	NA	important role in the immune response to viral infection	Real-time RT-PCR, Calcium influx assay	24819048	2014	NA
PRRID_1479	Maltose-binding protein (MBP) Click for more detail	E. coli(Bacteria)	MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK	396	Pattern-associated molecular patterns (PAMPs)	Natural	purification of recombinant proteins as a protein tag	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Cell Surface (Exogenous)	Q9QUN7.fasta	Q9QUN7	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA, Phagocytosis assay, Cytokine secretion assay, real-time PCR	24825603	2014	Pubchem_assay
PRRID_1479	Maltose-binding protein (MBP) Click for more detail	E. coli(Bacteria)	MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK	396	Pattern-associated molecular patterns (PAMPs)	Natural	purification of recombinant proteins as a protein tag	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Cell Surface (Exogenous)	Q9QUN7.fasta	Q9QUN7	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA, Phagocytosis assay, Cytokine secretion assay, real-time PCR	24825603	2014	Pubchem_assay
PRRID_1480	Maltose-binding protein (MBP) Click for more detail	E. coli(Bacteria)	MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK	396	Pattern-associated molecular patterns (PAMPs)	Natural	induce dendritic cell activation and the production of pro-inflammatory cytokines	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	peritoneal macrophages	transmembrane	Q9QUK6.fasta	Q9QUK6	835	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA, Phagocytosis assay, Cytokine secretion assay, real-time PCR	24825603	2014	Pubchem_assay
PRRID_1480	Maltose-binding protein (MBP) Click for more detail	E. coli(Bacteria)	MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK	396	Pattern-associated molecular patterns (PAMPs)	Natural	induce dendritic cell activation and the production of pro-inflammatory cytokines	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	peritoneal macrophages	transmembrane	Q9QUK6.fasta	Q9QUK6	835	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA, Phagocytosis assay, Cytokine secretion assay, real-time PCR	24825603	2014	Pubchem_assay
PRRID_1481	Maltose-binding protein (MBP) Click for more detail	E. coli(Bacteria)	MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK	396	Pattern-associated molecular patterns (PAMPs)	Natural	responsible for the uptake and efficient catabolism of maltodextrins	Mannose Receptor (CD206)	Mannose receptor (MR)	Mice	peritoneal macrophages	cell surface	Q61830.fasta	Q61830	1456	Phagocytosis of pathogens, Antigen presentation, Intracellular signalling, Resolution of inflammation	ELISA, Phagocytosis assay, Cytokine secretion assay, real-time PCR	24825603	2014	Pubchem_assay
PRRID_1481	Maltose-binding protein (MBP) Click for more detail	E. coli(Bacteria)	MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK	396	Pattern-associated molecular patterns (PAMPs)	Natural	responsible for the uptake and efficient catabolism of maltodextrins	Mannose Receptor (CD206)	Mannose receptor (MR)	Mice	peritoneal macrophages	cell surface	Q61830.fasta	Q61830	1456	Phagocytosis of pathogens, Antigen presentation, Intracellular signalling, Resolution of inflammation	ELISA, Phagocytosis assay, Cytokine secretion assay, real-time PCR	24825603	2014	Pubchem_assay
PRRID_1487	monomeric flagellin Click for more detail	Bacteria	MAQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATTGTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGANDNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLTGITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVANDGTVTMATGATANATVTDANTTKATTITSGGTPVQIDNTAGSATANLGAVSLVKLQDSKGNDTDTYALKDTNGNLYAADVNETTGAVSVKTITYTDSSGAASSPTAVKLGGDDGKTEVVDIDGKTYDSADLNGGNLQTGLTAGGEALTAVANGKTTDPLKALDDAIASVDKFRSSLGAVQNRLDSAVTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQVPQQVLSLLQG	498	Pattern-associated molecular patterns (PAMPs)	Natural	It directly interac with TLR 5 and induces immune response	PGLYRP-2	Peptidoglycan Recognition Receptor (PGRPs)	Mice	monocyte/macrophages, DCs	Cell Surface (Exogenous)	Q9JLF7.fasta	Q9JLF7	859	It stimulates the production of proinflammatory cytokines, such as TNF-Œ±, through signaling via the adaptor protein MyD88.	reverse transcription‚Äìpolymerase chain reaction (RT‚ÄìPCR), real-time RT‚ÄìPCR, flow cytometry, immunocytochemistry and Western blot analysis.	24828022	2014	Pubchem_assay
PRRID_1487	monomeric flagellin Click for more detail	Bacteria	MAQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATTGTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGANDNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLTGITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVANDGTVTMATGATANATVTDANTTKATTITSGGTPVQIDNTAGSATANLGAVSLVKLQDSKGNDTDTYALKDTNGNLYAADVNETTGAVSVKTITYTDSSGAASSPTAVKLGGDDGKTEVVDIDGKTYDSADLNGGNLQTGLTAGGEALTAVANGKTTDPLKALDDAIASVDKFRSSLGAVQNRLDSAVTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQVPQQVLSLLQG	498	Pattern-associated molecular patterns (PAMPs)	Natural	It directly interac with TLR 5 and induces immune response	PGLYRP-2	Peptidoglycan Recognition Receptor (PGRPs)	Mice	monocyte/macrophages, DCs	Cell Surface (Exogenous)	Q9JLF7.fasta	Q9JLF7	859	It stimulates the production of proinflammatory cytokines, such as TNF-Œ±, through signaling via the adaptor protein MyD88.	reverse transcription‚Äìpolymerase chain reaction (RT‚ÄìPCR), real-time RT‚ÄìPCR, flow cytometry, immunocytochemistry and Western blot analysis.	24828022	2014	Pubchem_assay
PRRID_1513	naloxone Click for more detail	synthetic alkaloids (others)	O=C1[C@@H]2OC3=C(O)C=CC4=C3[C@@]2([C@]5(CC1)O)CCN(CC=C)[C@@H]5C4	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	It is primarily used for pain relief, cough and constipation	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	spinal microglia, macrophage and astrocytes	cell surface	Q9QUK6.fasta	Q9QUK6	835	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	NA	24824631	2014	Pubchem_assay
PRRID_1513	naloxone Click for more detail	synthetic alkaloids (others)	O=C1[C@@H]2OC3=C(O)C=CC4=C3[C@@]2([C@]5(CC1)O)CCN(CC=C)[C@@H]5C4	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	It is primarily used for pain relief, cough and constipation	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	spinal microglia, macrophage and astrocytes	cell surface	Q9QUK6.fasta	Q9QUK6	835	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	NA	24824631	2014	Pubchem_assay
PRRID_1517	ODN2006 Click for more detail	Bacteria	5‚Äô-tcgtcgttttgtcgttttgtcgtt-3‚Äô	24	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce strong immunostimulatory effects trough activation of TLR9 in mammalian cells and type B CpG ODN2006 significantly induced IL-1b and IFN-a1	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	NA	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1517	ODN2006 Click for more detail	Bacteria	5‚Äô-tcgtcgttttgtcgttttgtcgtt-3‚Äô	24	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce strong immunostimulatory effects trough activation of TLR9 in mammalian cells and type B CpG ODN2006 significantly induced IL-1b and IFN-a1	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	NA	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1519	Paclitaxel Click for more detail	Pacific yew (plant)	C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	used to treat a number of types of cancer	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF)	Q9QUK6.fasta	Q9QUK6	835	plays a fundamental role in pathogen recognition and activation of innate immunity	NA	24754320	2014	Pubchem_assay
PRRID_1519	Paclitaxel Click for more detail	Pacific yew (plant)	C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	used to treat a number of types of cancer	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF)	Q9QUK6.fasta	Q9QUK6	835	plays a fundamental role in pathogen recognition and activation of innate immunity	NA	24754320	2014	Pubchem_assay
PRRID_1520	Paclitaxel Click for more detail	Pacific yew (plant)	C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	used to treat a number of types of cancer	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF)	O00206.fasta	O00206	839	plays a fundamental role in pathogen recognition and activation of innate immunity	NA	24754320	2014	Pubchem_assay
PRRID_1520	Paclitaxel Click for more detail	Pacific yew (plant)	C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	used to treat a number of types of cancer	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF)	O00206.fasta	O00206	839	plays a fundamental role in pathogen recognition and activation of innate immunity	NA	24754320	2014	Pubchem_assay
PRRID_1525	Pam3CSK4 Click for more detail	Gram-positive and negative bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	mast cells	cytoplasmic domain	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	Real-time PCR	24818634	2014	NA
PRRID_1525	Pam3CSK4 Click for more detail	Gram-positive and negative bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	mast cells	cytoplasmic domain	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	Real-time PCR	24818634	2014	NA
PRRID_1533	Pam3CSK4 + Ara-C Click for more detail	NA	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	enhanced the expressions of several immunomodulatory molecules and increased their sensitivity to effector cells of the immune system leading to decreased tumorigenicity of B-cell lymphoma cells.	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Em-Myc Mice (a Mouse model for Human Burkitt lymphoma and non-Hodgkin lymphomas)	B-cell lymphoma cell lines	cell surface	NA	NA	NA	Cotreatment of cells with Pam3CSK4 and Ara-C induced the expression of a number of several immunomodulatory molecules including cell surface proteins, cytokines, and chemokines.	ELISA	24799523	2014	NA
PRRID_1533	Pam3CSK4 + Ara-C Click for more detail	NA	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	enhanced the expressions of several immunomodulatory molecules and increased their sensitivity to effector cells of the immune system leading to decreased tumorigenicity of B-cell lymphoma cells.	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Em-Myc Mice (a Mouse model for Human Burkitt lymphoma and non-Hodgkin lymphomas)	B-cell lymphoma cell lines	cell surface	NA	NA	NA	Cotreatment of cells with Pam3CSK4 and Ara-C induced the expression of a number of several immunomodulatory molecules including cell surface proteins, cytokines, and chemokines.	ELISA	24799523	2014	NA
PRRID_1567	poly I:C +CpG-ODN Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	highly immunostimulatory	NA	NA	Chicken	NA	NA	NA	NA	NA	highly immunostimulatory and show synergistic effect in cytokine production	ELISA	24797893	2014	NA
PRRID_1567	poly I:C +CpG-ODN Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	highly immunostimulatory	NA	NA	Chicken	NA	NA	NA	NA	NA	highly immunostimulatory and show synergistic effect in cytokine production	ELISA	24797893	2014	NA
PRRID_1595	R848 Click for more detail	Virus	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	Cell Compartment/Intracellular (Endosome)	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	ELISA	24825342	2014	Pubchem_assay
PRRID_1595	R848 Click for more detail	Virus	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	Cell Compartment/Intracellular (Endosome)	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	ELISA	24825342	2014	Pubchem_assay
PRRID_1596	R848 Click for more detail	Virus	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice	plasmacytoid and myeloid DCs	cell compartment	P58682.fasta	P58682	1032	important role in the immune response to viral infection	ELISA	24771854	2014	Pubchem_assay
PRRID_1596	R848 Click for more detail	Virus	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice	plasmacytoid and myeloid DCs	cell compartment	P58682.fasta	P58682	1032	important role in the immune response to viral infection	ELISA	24771854	2014	Pubchem_assay
PRRID_1597	R848 Click for more detail	Virus	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	cell compartment	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	ELISA	24771854	2014	Pubchem_assay
PRRID_1597	R848 Click for more detail	Virus	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	cell compartment	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	ELISA	24771854	2014	Pubchem_assay
PRRID_1598	R848 Click for more detail	Virus	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice	plasmacytoid and myeloid DCs	cell compartment	P58682.fasta	P58682	1032	important role in the immune response to viral infection	ELISA	24771328	2014	Pubchem_assay
PRRID_1598	R848 Click for more detail	Virus	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Mice	plasmacytoid and myeloid DCs	cell compartment	P58682.fasta	P58682	1032	important role in the immune response to viral infection	ELISA	24771328	2014	Pubchem_assay
PRRID_1599	R848 Click for more detail	Virus	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	cell compartment	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	ELISA	24771328	2014	Pubchem_assay
PRRID_1599	R848 Click for more detail	Virus	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	cell compartment	Q9NR97.fasta	Q9NR97	1041	important role in the immune response to viral infection	ELISA	24771328	2014	Pubchem_assay

previous 123 4 5 6 7 8 9...15 16 next