Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_1191 | Bropirimine Click for more detail | NA | C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | experimental drug with anti-cancer and antiviral properties | DUOX2 | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NA | 24830024 | 2014 | Pubchem_assay |
| PRRID_1191 | Bropirimine Click for more detail | NA | C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | experimental drug with anti-cancer and antiviral properties | DUOX2 | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NA | 24830024 | 2014 | Pubchem_assay |
| PRRID_1205 | CL075 Click for more detail | Thiazoloquinoline compound (others) | CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | stimulates TLR8 in human peripheral blood mononuclear cells. It activates NF-κB and triggers preferentially the production of TNF-α and IL-12 | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | lung cancer cells | cell compartment | Q9NR97.fasta | Q9NR97 | 1041 | binding of TLR8 to its ligand stimulated cell proliferation | MTT assay, Cell Proliferation Assay | 24782650 | 2014 | Pubchem_assay |
| PRRID_1205 | CL075 Click for more detail | Thiazoloquinoline compound (others) | CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | stimulates TLR8 in human peripheral blood mononuclear cells. It activates NF-κB and triggers preferentially the production of TNF-α and IL-12 | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | lung cancer cells | cell compartment | Q9NR97.fasta | Q9NR97 | 1041 | binding of TLR8 to its ligand stimulated cell proliferation | MTT assay, Cell Proliferation Assay | 24782650 | 2014 | Pubchem_assay |
| PRRID_1206 | CL075 Click for more detail | Thiazoloquinoline compound (others) | CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | stimulates TLR8 in human peripheral blood mononuclear cells. It activates NF-κB and triggers preferentially the production of TNF-α and IL-12 | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Mice | dendritic cells, macrophages, natural killer cells | cell compartment | NA | NA | NA | important role in the immune response to viral infection | ELISA | 24771328 | 2014 | NA |
| PRRID_1206 | CL075 Click for more detail | Thiazoloquinoline compound (others) | CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | stimulates TLR8 in human peripheral blood mononuclear cells. It activates NF-κB and triggers preferentially the production of TNF-α and IL-12 | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Mice | dendritic cells, macrophages, natural killer cells | cell compartment | NA | NA | NA | important role in the immune response to viral infection | ELISA | 24771328 | 2014 | NA |
| PRRID_1207 | CL075 Click for more detail | Thiazoloquinoline compound (others) | CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | stimulates TLR8 in human peripheral blood mononuclear cells. It activates NF-κB and triggers preferentially the production of TNF-α and IL-12 | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | dendritic cells, macrophages, natural killer cells | cell compartment | NA | NA | NA | important role in the immune response to viral infection | ELISA | 24771328 | 2014 | NA |
| PRRID_1207 | CL075 Click for more detail | Thiazoloquinoline compound (others) | CCCC1=NC2=C(S1)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | stimulates TLR8 in human peripheral blood mononuclear cells. It activates NF-κB and triggers preferentially the production of TNF-α and IL-12 | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | dendritic cells, macrophages, natural killer cells | cell compartment | NA | NA | NA | important role in the immune response to viral infection | ELISA | 24771328 | 2014 | NA |
| PRRID_1213 | CpG motif Click for more detail | Bacteria | NA | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | act as immuno stimulants | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | mast cells | Cell Compartment/Intracellular (Endosome) | Q9NR96.fasta | Q9NR96 | 1032 | TLR9 plays a crucial role in breaking tolerance and developing autoimmunity | Real-time PCR | 24818634 | 2014 | Pubchem_assay |
| PRRID_1213 | CpG motif Click for more detail | Bacteria | NA | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | act as immuno stimulants | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | mast cells | Cell Compartment/Intracellular (Endosome) | Q9NR96.fasta | Q9NR96 | 1032 | TLR9 plays a crucial role in breaking tolerance and developing autoimmunity | Real-time PCR | 24818634 | 2014 | Pubchem_assay |
| PRRID_1231 | dextran sodium sulphate and radiation Click for more detail | NA | CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | control intestinal epithelial homeostasis and provide protection from injury | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs | cell surface | Q9QUN7.fasta | Q9QUN7 | 784 | NA | reverse transcription–polymerase chain reaction (RT–PCR), real-time RT–PCR, flow cytometry, immunocytochemistry and Western blot analysis. | 24828022 | 2014 | Pubchem_assay |
| PRRID_1231 | dextran sodium sulphate and radiation Click for more detail | NA | CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | control intestinal epithelial homeostasis and provide protection from injury | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs | cell surface | Q9QUN7.fasta | Q9QUN7 | 784 | NA | reverse transcription–polymerase chain reaction (RT–PCR), real-time RT–PCR, flow cytometry, immunocytochemistry and Western blot analysis. | 24828022 | 2014 | Pubchem_assay |
| PRRID_1232 | dextran sodium sulphate and radiation Click for more detail | NA | CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | control intestinal epithelial homeostasis and provide protection from injury | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | NA | reverse transcription–polymerase chain reaction (RT–PCR), real-time RT–PCR, flow cytometry, immunocytochemistry and Western blot analysis. | 24828022 | 2014 | Pubchem_assay |
| PRRID_1232 | dextran sodium sulphate and radiation Click for more detail | NA | CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | control intestinal epithelial homeostasis and provide protection from injury | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | NA | reverse transcription–polymerase chain reaction (RT–PCR), real-time RT–PCR, flow cytometry, immunocytochemistry and Western blot analysis. | 24828022 | 2014 | Pubchem_assay |
| PRRID_1233 | dextran sodium sulphate and radiation Click for more detail | NA | CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | control intestinal epithelial homeostasis and provide protection from injury | Toll-like receptor 5 (TLR5) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs | cell surface | Q9JLF7.fasta | Q9JLF7 | 859 | NA | reverse transcription–polymerase chain reaction (RT–PCR), real-time RT–PCR, flow cytometry, immunocytochemistry and Western blot analysis. | 24828022 | 2014 | Pubchem_assay |
| PRRID_1233 | dextran sodium sulphate and radiation Click for more detail | NA | CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | control intestinal epithelial homeostasis and provide protection from injury | Toll-like receptor 5 (TLR5) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs | cell surface | Q9JLF7.fasta | Q9JLF7 | 859 | NA | reverse transcription–polymerase chain reaction (RT–PCR), real-time RT–PCR, flow cytometry, immunocytochemistry and Western blot analysis. | 24828022 | 2014 | Pubchem_assay |
| PRRID_1236 | Diacylated Lipopeptide Click for more detail | Mycoplasma (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 6 (TLR6) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, mast cells and B-lymphocytes | cell surface | Q9EPW9.fasta | Q9EPW9 | 795 | significant role in the pathogenesis of severe inflammatory responses | NA | 24807166 | 2014 | Pubchem_assay |
| PRRID_1236 | Diacylated Lipopeptide Click for more detail | Mycoplasma (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 6 (TLR6) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, mast cells and B-lymphocytes | cell surface | Q9EPW9.fasta | Q9EPW9 | 795 | significant role in the pathogenesis of severe inflammatory responses | NA | 24807166 | 2014 | Pubchem_assay |
| PRRID_1237 | Diacylated Lipopeptide Click for more detail | Mycoplasma (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 6 (TLR6) | Toll-like receptor (TLR) | Human | monocyte/macrophages, mast cells and B-lymphocytes | cell surface | Q9Y2C9.fasta | Q9Y2C9 | 796 | significant role in the pathogenesis of severe inflammatory responses | NA | 24807166 | 2014 | Pubchem_assay |
| PRRID_1237 | Diacylated Lipopeptide Click for more detail | Mycoplasma (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 6 (TLR6) | Toll-like receptor (TLR) | Human | monocyte/macrophages, mast cells and B-lymphocytes | cell surface | Q9Y2C9.fasta | Q9Y2C9 | 796 | significant role in the pathogenesis of severe inflammatory responses | NA | 24807166 | 2014 | Pubchem_assay |
| PRRID_1268 | fetuin A (Fet-A) Click for more detail | Fetal bovine serum (others) | MKSFVLLFCLAQLWGCHSIPLDPVAGYKEPACDDPDTEQAALAAVDYINKHLPRGYKHTLNQIDSVKVWPRRPTGEVYDIEIDTLETTCHVLDPTPLANCSVRQQTQHAVEGDCDIHVLKQDGQFSVLFTKCDSSPDSAEDVRKLCPDCPLLAPLNDSRVVHAVEVALATFNAESNGSYLQLVEISRAQFVPLPVSVSVEFAVAATDCIAKEVVDPTKCNLLAEKQYGFCKGSVIQKALGGEDVRVTCTLFQTQPVIPQPQPDGAEAEAPSAVPDAAGPTPSAAGPPVASVVVGPSVVAVPLPLHRAHYDLRHTFSGVASVESSSGEAFHVGKTPIVGQPSIPGGPVRLCPGRIRYFKI | 359 | Pattern-associated molecular patterns (PAMPs) | Natural | associated with atherosclerosis. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte | cell surface | O00206.fasta | O00206 | 839 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | ELISA | 24823872 | 2014 | Pubchem_assay |
| PRRID_1268 | fetuin A (Fet-A) Click for more detail | Fetal bovine serum (others) | MKSFVLLFCLAQLWGCHSIPLDPVAGYKEPACDDPDTEQAALAAVDYINKHLPRGYKHTLNQIDSVKVWPRRPTGEVYDIEIDTLETTCHVLDPTPLANCSVRQQTQHAVEGDCDIHVLKQDGQFSVLFTKCDSSPDSAEDVRKLCPDCPLLAPLNDSRVVHAVEVALATFNAESNGSYLQLVEISRAQFVPLPVSVSVEFAVAATDCIAKEVVDPTKCNLLAEKQYGFCKGSVIQKALGGEDVRVTCTLFQTQPVIPQPQPDGAEAEAPSAVPDAAGPTPSAAGPPVASVVVGPSVVAVPLPLHRAHYDLRHTFSGVASVESSSGEAFHVGKTPIVGQPSIPGGPVRLCPGRIRYFKI | 359 | Pattern-associated molecular patterns (PAMPs) | Natural | associated with atherosclerosis. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte | cell surface | O00206.fasta | O00206 | 839 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | ELISA | 24823872 | 2014 | Pubchem_assay |
| PRRID_1304 | GLA( Glucopyranosyl lipid adjuvant) Click for more detail | NA | NA | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Spleen cells | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | plays a fundamental role in pathogen recognition and activation of innate immunity | whole blood assay (WBA), ELISA | 24766820 | 2014 | Pubchem_assay |
| PRRID_1304 | GLA( Glucopyranosyl lipid adjuvant) Click for more detail | NA | NA | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Spleen cells | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | plays a fundamental role in pathogen recognition and activation of innate immunity | whole blood assay (WBA), ELISA | 24766820 | 2014 | Pubchem_assay |
| PRRID_1305 | GLA( Glucopyranosyl lipid adjuvant) Click for more detail | NA | NA | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Spleen cells | cell surface | O00206.fasta | O00206 | 839 | plays a fundamental role in pathogen recognition and activation of innate immunity | whole blood assay (WBA), ELISA | 24766820 | 2014 | Pubchem_assay |
| PRRID_1305 | GLA( Glucopyranosyl lipid adjuvant) Click for more detail | NA | NA | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Spleen cells | cell surface | O00206.fasta | O00206 | 839 | plays a fundamental role in pathogen recognition and activation of innate immunity | whole blood assay (WBA), ELISA | 24766820 | 2014 | Pubchem_assay |
| PRRID_1326 | Heparan sulfate Click for more detail | pulmonary vascular cells (e.g., endothelial cells) (others) | COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | released in responses to local stresses (hypoxia or inflammation) | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human Platelets | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte | Leucine-rich Repeat (LRR) Domain | Q7L0X0.fasta | Q7L0X0 | 811 | TLR4 is expressed on platelets which mediates inflammatory and immune responses in a variety of diseases including PAH (pulmonary arterial hypertension) | NA | 24812346 | 2014 | Pubchem_assay |
| PRRID_1326 | Heparan sulfate Click for more detail | pulmonary vascular cells (e.g., endothelial cells) (others) | COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | released in responses to local stresses (hypoxia or inflammation) | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human Platelets | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte | Leucine-rich Repeat (LRR) Domain | Q7L0X0.fasta | Q7L0X0 | 811 | TLR4 is expressed on platelets which mediates inflammatory and immune responses in a variety of diseases including PAH (pulmonary arterial hypertension) | NA | 24812346 | 2014 | Pubchem_assay |
| PRRID_1327 | Heparan sulfate Click for more detail | Host (Endogenous) (others) | COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | induce the maturation of DCs | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia | NA | 24807166 | 2014 | Pubchem_assay |
| PRRID_1327 | Heparan sulfate Click for more detail | Host (Endogenous) (others) | COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | induce the maturation of DCs | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia | NA | 24807166 | 2014 | Pubchem_assay |
| PRRID_1328 | Heparan sulfate Click for more detail | Host (Endogenous) (others) | COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | induce the maturation of DCs | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte | cell surface | O00206.fasta | O00206 | 839 | Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia | NA | 24807166 | 2014 | Pubchem_assay |
| PRRID_1328 | Heparan sulfate Click for more detail | Host (Endogenous) (others) | COC1C(C(C(OC1C(=O)[O-])OC2C(OC(C(C2[O-])NOS(=O)(=O)O)OC)COS(=O)(=O)O)OS(=O)(=O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | induce the maturation of DCs | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte | cell surface | O00206.fasta | O00206 | 839 | Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia | NA | 24807166 | 2014 | Pubchem_assay |
| PRRID_1364 | iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail | Gram-negative and Gram-positive bacteria | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | activate NF-κB | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | European and African Children | signals via a caspase- activated recruitment domain (CARD) | signals via a caspase- activated recruitment domain (CARD) | Q9Y239.fasta | Q9Y239 | 953 | plays a fundamental role in pathogen recognition and activation of innate immunity | ELISA | 24743542 | 2014 | Pubchem_assay |
| PRRID_1364 | iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail | Gram-negative and Gram-positive bacteria | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | activate NF-κB | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | European and African Children | signals via a caspase- activated recruitment domain (CARD) | signals via a caspase- activated recruitment domain (CARD) | Q9Y239.fasta | Q9Y239 | 953 | plays a fundamental role in pathogen recognition and activation of innate immunity | ELISA | 24743542 | 2014 | Pubchem_assay |
| PRRID_1365 | IL-2 and R848 Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC (Antibody forming cells) | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | monocyte/macrophages, DCs, mast cells | Cell Compartment/Intracellular (Endosome) | NA | NA | NA | selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC | ELISPOT assay, Proliferation assay | 24828435 | 2014 | NA |
| PRRID_1365 | IL-2 and R848 Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC (Antibody forming cells) | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Human | monocyte/macrophages, DCs, mast cells | Cell Compartment/Intracellular (Endosome) | NA | NA | NA | selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC | ELISPOT assay, Proliferation assay | 24828435 | 2014 | NA |
| PRRID_1366 | IL-2 and R848 Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC (Antibody forming cells) | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, mast cells | Cell Compartment/Intracellular (Endosome) | NA | NA | NA | selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC | ELISPOT assay, Proliferation assay | 24828435 | 2014 | NA |
| PRRID_1366 | IL-2 and R848 Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC (Antibody forming cells) | Toll-like receptor 7/8 (TLR7/8) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, mast cells | Cell Compartment/Intracellular (Endosome) | NA | NA | NA | selectively stimulate human memory B cells, leading to differentiation of IgG-secreting AFC | ELISPOT assay, Proliferation assay | 24828435 | 2014 | NA |
| PRRID_1367 | Imidazoquinoline Click for more detail | tricyclic organic molecule (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | induce type I IFN, antiviral and antitumor therapeutic molecules | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 24830024 | 2014 | Pubchem_assay |
| PRRID_1367 | Imidazoquinoline Click for more detail | tricyclic organic molecule (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | induce type I IFN, antiviral and antitumor therapeutic molecules | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 24830024 | 2014 | Pubchem_assay |
| PRRID_1368 | Imidazoquinoline Click for more detail | tricyclic organic molecule (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | induce type I IFN, antiviral and antitumor therapeutic molecules | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, mast cells | Cell Compartment/Intracellular (Endosome) | P58682.fasta | P58682 | 1032 | important role in the immune response to viral infection | NA | 24830024 | 2014 | Pubchem_assay |
| PRRID_1368 | Imidazoquinoline Click for more detail | tricyclic organic molecule (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | induce type I IFN, antiviral and antitumor therapeutic molecules | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, mast cells | Cell Compartment/Intracellular (Endosome) | P58682.fasta | P58682 | 1032 | important role in the immune response to viral infection | NA | 24830024 | 2014 | Pubchem_assay |
| PRRID_1369 | imidazoquinoline (R848 (also known as Resiquimod)) Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | monocyte-derived dendritic cells,polymorphonuclear leukocytes (PMN) | extracellular domain (ECD) | Q9NYK1.fasta | Q9NYK1 | 1049 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1369 | imidazoquinoline (R848 (also known as Resiquimod)) Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | monocyte-derived dendritic cells,polymorphonuclear leukocytes (PMN) | extracellular domain (ECD) | Q9NYK1.fasta | Q9NYK1 | 1049 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1370 | imidazoquinoline (R848 (also known as Resiquimod)) Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | monocyte-derived dendritic cells,polymorphonuclear leukocytes (PMN) | extracellular domain (ECD) | Q9NR97.fasta | Q9NR97 | 1041 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1370 | imidazoquinoline (R848 (also known as Resiquimod)) Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | monocyte-derived dendritic cells,polymorphonuclear leukocytes (PMN) | extracellular domain (ECD) | Q9NR97.fasta | Q9NR97 | 1041 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1371 | Imiquimod Click for more detail | Virus | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune modulators | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | mast cells | Cell Compartment/Intracellular (Endosome) | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | Real-time PCR | 24818634 | 2014 | Pubchem_assay |
| PRRID_1371 | Imiquimod Click for more detail | Virus | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune modulators | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | mast cells | Cell Compartment/Intracellular (Endosome) | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | Real-time PCR | 24818634 | 2014 | Pubchem_assay |
| PRRID_1372 | Imiquimod Click for more detail | NA | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | Spleen cells | cell compartment | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | whole blood assay (WBA), ELISA | 24766820 | 2014 | Pubchem_assay |
| PRRID_1372 | Imiquimod Click for more detail | NA | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | Spleen cells | cell compartment | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | whole blood assay (WBA), ELISA | 24766820 | 2014 | Pubchem_assay |
| PRRID_1373 | Imiquimod Click for more detail | NA | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | Spleen cells | cell compartment | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | whole blood assay (WBA), ELISA | 24766820 | 2014 | Pubchem_assay |
| PRRID_1373 | Imiquimod Click for more detail | NA | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | Spleen cells | cell compartment | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | whole blood assay (WBA), ELISA | 24766820 | 2014 | Pubchem_assay |
| PRRID_1374 | Imiquimod Click for more detail | NA | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | activates anti-tumor immunity | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | skin samples | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | MTT assay | 24743316 | 2014 | Pubchem_assay |
| PRRID_1374 | Imiquimod Click for more detail | NA | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | activates anti-tumor immunity | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | skin samples | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | MTT assay | 24743316 | 2014 | Pubchem_assay |
| PRRID_1375 | Imiquimod Click for more detail | imidazoquinoline amine analogue to guanosine (others) | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | induced significant up-regulation of IL-1b, IL-6, IL-8, IL-10, IFN-c, IFN-a1 and Mx | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | Real-time PCR | 24736205 | 2014 | Pubchem_assay |
| PRRID_1375 | Imiquimod Click for more detail | imidazoquinoline amine analogue to guanosine (others) | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | induced significant up-regulation of IL-1b, IL-6, IL-8, IL-10, IFN-c, IFN-a1 and Mx | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | Real-time PCR | 24736205 | 2014 | Pubchem_assay |
| PRRID_1383 | isomers of opioid ligands Click for more detail | opioid (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | It is primarily used for pain relief, cough and constipation | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | spinal microglia, macrophage and astrocytes | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | NA | 24824631 | 2014 | Pubchem_assay |
| PRRID_1383 | isomers of opioid ligands Click for more detail | opioid (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | It is primarily used for pain relief, cough and constipation | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | spinal microglia, macrophage and astrocytes | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | NA | 24824631 | 2014 | Pubchem_assay |
| PRRID_1384 | isomers of opioids Click for more detail | opioid (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | It is primarily used for pain relief, cough and constipation | mu opioid receptors | mu opioid receptors | Mice | central nervous system. mu opioid receptors are found on pre- and post-synaptic nociceptive neurons, as well as on astrocytes and microglia | NA | P42866.fasta | P42866 | 398 | It is an inhibitory G-protein coupled receptor | NA | 24824631 | 2014 | Pubchem_assay |
| PRRID_1384 | isomers of opioids Click for more detail | opioid (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | It is primarily used for pain relief, cough and constipation | mu opioid receptors | mu opioid receptors | Mice | central nervous system. mu opioid receptors are found on pre- and post-synaptic nociceptive neurons, as well as on astrocytes and microglia | NA | P42866.fasta | P42866 | 398 | It is an inhibitory G-protein coupled receptor | NA | 24824631 | 2014 | Pubchem_assay |
| PRRID_1458 | low molecular weight molecules of the imidazoquinoline family Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | induce type I IFN, antiviral and antitumor therapeutic molecules | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | plasmacytoid and myeloid DCs | extracellular domain (ECD) | Q9NYK1.fasta | Q9NYK1 | 1049 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1458 | low molecular weight molecules of the imidazoquinoline family Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | induce type I IFN, antiviral and antitumor therapeutic molecules | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | plasmacytoid and myeloid DCs | extracellular domain (ECD) | Q9NYK1.fasta | Q9NYK1 | 1049 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1459 | low molecular weight molecules of the imidazoquinoline family Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | induce type I IFN, antiviral and antitumor therapeutic molecules | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | plasmacytoid and myeloid DCs | extracellular domain (ECD) | Q9NR97.fasta | Q9NR97 | 1041 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1459 | low molecular weight molecules of the imidazoquinoline family Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | induce type I IFN, antiviral and antitumor therapeutic molecules | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | plasmacytoid and myeloid DCs | extracellular domain (ECD) | Q9NR97.fasta | Q9NR97 | 1041 | controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation | Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot | 24813206 | 2014 | Pubchem_assay |
| PRRID_1460 | Loxoribine (7-allyl-7,8-dihydro-8-oxo-guanosine) Click for more detail | Guanosine (others) | C=CCN1C2=C(NC(=NC2=O)N)N(C1=O)C3C(C(C(O3)CO)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | It activates the innate immune system through Toll-like receptor 7 | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 24830024 | 2014 | Pubchem_assay |
| PRRID_1460 | Loxoribine (7-allyl-7,8-dihydro-8-oxo-guanosine) Click for more detail | Guanosine (others) | C=CCN1C2=C(NC(=NC2=O)N)N(C1=O)C3C(C(C(O3)CO)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | It activates the innate immune system through Toll-like receptor 7 | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 24830024 | 2014 | Pubchem_assay |
| PRRID_1461 | Loxoribine (7-allyl-7,8-dihydro-8-oxo-guanosine) Click for more detail | Guanosine (others) | C=CCN1C2=C(NC(=NC2=O)N)N(C1=O)C3C(C(C(O3)CO)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | It activates the innate immune system through Toll-like receptor 7 | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Guinea Pig | plasmacytoid and myeloid DCs | Cell Compartment/Intracellular (Endosome) | NA | NA | NA | important role in the immune response to viral infection | Real-time RT-PCR, Calcium influx assay | 24819048 | 2014 | NA |
| PRRID_1461 | Loxoribine (7-allyl-7,8-dihydro-8-oxo-guanosine) Click for more detail | Guanosine (others) | C=CCN1C2=C(NC(=NC2=O)N)N(C1=O)C3C(C(C(O3)CO)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | It activates the innate immune system through Toll-like receptor 7 | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Guinea Pig | plasmacytoid and myeloid DCs | Cell Compartment/Intracellular (Endosome) | NA | NA | NA | important role in the immune response to viral infection | Real-time RT-PCR, Calcium influx assay | 24819048 | 2014 | NA |
| PRRID_1479 | Maltose-binding protein (MBP) Click for more detail | E. coli(Bacteria) | MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | purification of recombinant proteins as a protein tag | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells | Cell Surface (Exogenous) | Q9QUN7.fasta | Q9QUN7 | 784 | plays a fundamental role in pathogen recognition and activation of innate immunity | ELISA, Phagocytosis assay, Cytokine secretion assay, real-time PCR | 24825603 | 2014 | Pubchem_assay |
| PRRID_1479 | Maltose-binding protein (MBP) Click for more detail | E. coli(Bacteria) | MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | purification of recombinant proteins as a protein tag | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells | Cell Surface (Exogenous) | Q9QUN7.fasta | Q9QUN7 | 784 | plays a fundamental role in pathogen recognition and activation of innate immunity | ELISA, Phagocytosis assay, Cytokine secretion assay, real-time PCR | 24825603 | 2014 | Pubchem_assay |
| PRRID_1480 | Maltose-binding protein (MBP) Click for more detail | E. coli(Bacteria) | MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | induce dendritic cell activation and the production of pro-inflammatory cytokines | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | peritoneal macrophages | transmembrane | Q9QUK6.fasta | Q9QUK6 | 835 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | ELISA, Phagocytosis assay, Cytokine secretion assay, real-time PCR | 24825603 | 2014 | Pubchem_assay |
| PRRID_1480 | Maltose-binding protein (MBP) Click for more detail | E. coli(Bacteria) | MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | induce dendritic cell activation and the production of pro-inflammatory cytokines | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | peritoneal macrophages | transmembrane | Q9QUK6.fasta | Q9QUK6 | 835 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | ELISA, Phagocytosis assay, Cytokine secretion assay, real-time PCR | 24825603 | 2014 | Pubchem_assay |
| PRRID_1481 | Maltose-binding protein (MBP) Click for more detail | E. coli(Bacteria) | MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | responsible for the uptake and efficient catabolism of maltodextrins | Mannose Receptor (CD206) | Mannose receptor (MR) | Mice | peritoneal macrophages | cell surface | Q61830.fasta | Q61830 | 1456 | Phagocytosis of pathogens, Antigen presentation, Intracellular signalling, Resolution of inflammation | ELISA, Phagocytosis assay, Cytokine secretion assay, real-time PCR | 24825603 | 2014 | Pubchem_assay |
| PRRID_1481 | Maltose-binding protein (MBP) Click for more detail | E. coli(Bacteria) | MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | responsible for the uptake and efficient catabolism of maltodextrins | Mannose Receptor (CD206) | Mannose receptor (MR) | Mice | peritoneal macrophages | cell surface | Q61830.fasta | Q61830 | 1456 | Phagocytosis of pathogens, Antigen presentation, Intracellular signalling, Resolution of inflammation | ELISA, Phagocytosis assay, Cytokine secretion assay, real-time PCR | 24825603 | 2014 | Pubchem_assay |
| PRRID_1487 | monomeric flagellin Click for more detail | Bacteria | MAQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATTGTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGANDNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLTGITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVANDGTVTMATGATANATVTDANTTKATTITSGGTPVQIDNTAGSATANLGAVSLVKLQDSKGNDTDTYALKDTNGNLYAADVNETTGAVSVKTITYTDSSGAASSPTAVKLGGDDGKTEVVDIDGKTYDSADLNGGNLQTGLTAGGEALTAVANGKTTDPLKALDDAIASVDKFRSSLGAVQNRLDSAVTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQVPQQVLSLLQG | 498 | Pattern-associated molecular patterns (PAMPs) | Natural | It directly interac with TLR 5 and induces immune response | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Mice | monocyte/macrophages, DCs | Cell Surface (Exogenous) | Q9JLF7.fasta | Q9JLF7 | 859 | It stimulates the production of proinflammatory cytokines, such as TNF-α, through signaling via the adaptor protein MyD88. | reverse transcription–polymerase chain reaction (RT–PCR), real-time RT–PCR, flow cytometry, immunocytochemistry and Western blot analysis. | 24828022 | 2014 | Pubchem_assay |
| PRRID_1487 | monomeric flagellin Click for more detail | Bacteria | MAQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATTGTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGANDNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLTGITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVANDGTVTMATGATANATVTDANTTKATTITSGGTPVQIDNTAGSATANLGAVSLVKLQDSKGNDTDTYALKDTNGNLYAADVNETTGAVSVKTITYTDSSGAASSPTAVKLGGDDGKTEVVDIDGKTYDSADLNGGNLQTGLTAGGEALTAVANGKTTDPLKALDDAIASVDKFRSSLGAVQNRLDSAVTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQVPQQVLSLLQG | 498 | Pattern-associated molecular patterns (PAMPs) | Natural | It directly interac with TLR 5 and induces immune response | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Mice | monocyte/macrophages, DCs | Cell Surface (Exogenous) | Q9JLF7.fasta | Q9JLF7 | 859 | It stimulates the production of proinflammatory cytokines, such as TNF-α, through signaling via the adaptor protein MyD88. | reverse transcription–polymerase chain reaction (RT–PCR), real-time RT–PCR, flow cytometry, immunocytochemistry and Western blot analysis. | 24828022 | 2014 | Pubchem_assay |
| PRRID_1513 | naloxone Click for more detail | synthetic alkaloids (others) | O=C1[C@@H]2OC3=C(O)C=CC4=C3[C@@]2([C@]5(CC1)O)CCN(CC=C)[C@@H]5C4 | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | It is primarily used for pain relief, cough and constipation | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | spinal microglia, macrophage and astrocytes | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | NA | 24824631 | 2014 | Pubchem_assay |
| PRRID_1513 | naloxone Click for more detail | synthetic alkaloids (others) | O=C1[C@@H]2OC3=C(O)C=CC4=C3[C@@]2([C@]5(CC1)O)CCN(CC=C)[C@@H]5C4 | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | It is primarily used for pain relief, cough and constipation | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | spinal microglia, macrophage and astrocytes | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | NA | 24824631 | 2014 | Pubchem_assay |
| PRRID_1517 | ODN2006 Click for more detail | Bacteria | 5’-tcgtcgttttgtcgttttgtcgtt-3’ | 24 | Pattern-associated molecular patterns (PAMPs) | Synthetic | induce strong immunostimulatory effects trough activation of TLR9 in mammalian cells and type B CpG ODN2006 significantly induced IL-1b and IFN-a1 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | dendritic cells, macrophages, natural killer cells | NA | Q9NR96.fasta | Q9NR96 | 1032 | TLR9 plays a crucial role in breaking tolerance and developing autoimmunity | Real-time PCR | 24736205 | 2014 | Pubchem_assay |
| PRRID_1517 | ODN2006 Click for more detail | Bacteria | 5’-tcgtcgttttgtcgttttgtcgtt-3’ | 24 | Pattern-associated molecular patterns (PAMPs) | Synthetic | induce strong immunostimulatory effects trough activation of TLR9 in mammalian cells and type B CpG ODN2006 significantly induced IL-1b and IFN-a1 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | dendritic cells, macrophages, natural killer cells | NA | Q9NR96.fasta | Q9NR96 | 1032 | TLR9 plays a crucial role in breaking tolerance and developing autoimmunity | Real-time PCR | 24736205 | 2014 | Pubchem_assay |
| PRRID_1519 | Paclitaxel Click for more detail | Pacific yew (plant) | C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | used to treat a number of types of cancer | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte | signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF) | Q9QUK6.fasta | Q9QUK6 | 835 | plays a fundamental role in pathogen recognition and activation of innate immunity | NA | 24754320 | 2014 | Pubchem_assay |
| PRRID_1519 | Paclitaxel Click for more detail | Pacific yew (plant) | C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | used to treat a number of types of cancer | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte | signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF) | Q9QUK6.fasta | Q9QUK6 | 835 | plays a fundamental role in pathogen recognition and activation of innate immunity | NA | 24754320 | 2014 | Pubchem_assay |
| PRRID_1520 | Paclitaxel Click for more detail | Pacific yew (plant) | C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | used to treat a number of types of cancer | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte | signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF) | O00206.fasta | O00206 | 839 | plays a fundamental role in pathogen recognition and activation of innate immunity | NA | 24754320 | 2014 | Pubchem_assay |
| PRRID_1520 | Paclitaxel Click for more detail | Pacific yew (plant) | C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | used to treat a number of types of cancer | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte | signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF) | O00206.fasta | O00206 | 839 | plays a fundamental role in pathogen recognition and activation of innate immunity | NA | 24754320 | 2014 | Pubchem_assay |
| PRRID_1525 | Pam3CSK4 Click for more detail | Gram-positive and negative bacteria | CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-κB. | Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | mast cells | cytoplasmic domain | NA | NA | NA | TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6. | Real-time PCR | 24818634 | 2014 | NA |
| PRRID_1525 | Pam3CSK4 Click for more detail | Gram-positive and negative bacteria | CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-κB. | Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | mast cells | cytoplasmic domain | NA | NA | NA | TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6. | Real-time PCR | 24818634 | 2014 | NA |
| PRRID_1533 | Pam3CSK4 + Ara-C Click for more detail | NA | CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | enhanced the expressions of several immunomodulatory molecules and increased their sensitivity to effector cells of the immune system leading to decreased tumorigenicity of B-cell lymphoma cells. | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Em-Myc Mice (a Mouse model for Human Burkitt lymphoma and non-Hodgkin lymphomas) | B-cell lymphoma cell lines | cell surface | NA | NA | NA | Cotreatment of cells with Pam3CSK4 and Ara-C induced the expression of a number of several immunomodulatory molecules including cell surface proteins, cytokines, and chemokines. | ELISA | 24799523 | 2014 | NA |
| PRRID_1533 | Pam3CSK4 + Ara-C Click for more detail | NA | CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | enhanced the expressions of several immunomodulatory molecules and increased their sensitivity to effector cells of the immune system leading to decreased tumorigenicity of B-cell lymphoma cells. | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Em-Myc Mice (a Mouse model for Human Burkitt lymphoma and non-Hodgkin lymphomas) | B-cell lymphoma cell lines | cell surface | NA | NA | NA | Cotreatment of cells with Pam3CSK4 and Ara-C induced the expression of a number of several immunomodulatory molecules including cell surface proteins, cytokines, and chemokines. | ELISA | 24799523 | 2014 | NA |
| PRRID_1567 | poly I:C +CpG-ODN Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | highly immunostimulatory | NA | NA | Chicken | NA | NA | NA | NA | NA | highly immunostimulatory and show synergistic effect in cytokine production | ELISA | 24797893 | 2014 | NA |
| PRRID_1567 | poly I:C +CpG-ODN Click for more detail | NA | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | highly immunostimulatory | NA | NA | Chicken | NA | NA | NA | NA | NA | highly immunostimulatory and show synergistic effect in cytokine production | ELISA | 24797893 | 2014 | NA |
| PRRID_1595 | R848 Click for more detail | Virus | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune modulators | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | plasmacytoid and myeloid DCs | Cell Compartment/Intracellular (Endosome) | Q9NR97.fasta | Q9NR97 | 1041 | important role in the immune response to viral infection | ELISA | 24825342 | 2014 | Pubchem_assay |
| PRRID_1595 | R848 Click for more detail | Virus | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune modulators | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | plasmacytoid and myeloid DCs | Cell Compartment/Intracellular (Endosome) | Q9NR97.fasta | Q9NR97 | 1041 | important role in the immune response to viral infection | ELISA | 24825342 | 2014 | Pubchem_assay |
| PRRID_1596 | R848 Click for more detail | Virus | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune modulators | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Mice | plasmacytoid and myeloid DCs | cell compartment | P58682.fasta | P58682 | 1032 | important role in the immune response to viral infection | ELISA | 24771854 | 2014 | Pubchem_assay |
| PRRID_1596 | R848 Click for more detail | Virus | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune modulators | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Mice | plasmacytoid and myeloid DCs | cell compartment | P58682.fasta | P58682 | 1032 | important role in the immune response to viral infection | ELISA | 24771854 | 2014 | Pubchem_assay |
| PRRID_1597 | R848 Click for more detail | Virus | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune modulators | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | plasmacytoid and myeloid DCs | cell compartment | Q9NR97.fasta | Q9NR97 | 1041 | important role in the immune response to viral infection | ELISA | 24771854 | 2014 | Pubchem_assay |
| PRRID_1597 | R848 Click for more detail | Virus | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune modulators | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | plasmacytoid and myeloid DCs | cell compartment | Q9NR97.fasta | Q9NR97 | 1041 | important role in the immune response to viral infection | ELISA | 24771854 | 2014 | Pubchem_assay |
| PRRID_1598 | R848 Click for more detail | Virus | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune modulators | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Mice | plasmacytoid and myeloid DCs | cell compartment | P58682.fasta | P58682 | 1032 | important role in the immune response to viral infection | ELISA | 24771328 | 2014 | Pubchem_assay |
| PRRID_1598 | R848 Click for more detail | Virus | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune modulators | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Mice | plasmacytoid and myeloid DCs | cell compartment | P58682.fasta | P58682 | 1032 | important role in the immune response to viral infection | ELISA | 24771328 | 2014 | Pubchem_assay |
| PRRID_1599 | R848 Click for more detail | Virus | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune modulators | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | plasmacytoid and myeloid DCs | cell compartment | Q9NR97.fasta | Q9NR97 | 1041 | important role in the immune response to viral infection | ELISA | 24771328 | 2014 | Pubchem_assay |
| PRRID_1599 | R848 Click for more detail | Virus | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune modulators | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | Human | plasmacytoid and myeloid DCs | cell compartment | Q9NR97.fasta | Q9NR97 | 1041 | important role in the immune response to viral infection | ELISA | 24771328 | 2014 | Pubchem_assay |