Browse result page of AntiTbPdb
The total number entries retrieved from this search are 771
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1523 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from pig porcine | Mycobacterium avium | Mycobacterium avium susceptible strain | MIC= 50 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
antitb_1524 | NK-Lysin | NEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKD | Free | Free | None | Linear | 36 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | Reduction in bacterial growth inhibiton to 60% at conc. Of 9.37 mg/L | in vitro | NA | NA | NA | NA | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 |
antitb_1525 | N22 | VCEHIHLIRGLCHHLMHSYIKR | Free | Free | None | Linear | 21 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | Reduction in bacterial growth inhibiton to 59% at conc. Of 50 mg/L | in vitro | NA | NA | Low toxicity to erythrocyte | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
antitb_1526 | NKLF2 | VCDKMKILRGVCKKIMRSFLRR | Free | Free | None | Linear | 21 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
antitb_1527 | Human neutrohil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | cyclic | 30 | L | Cationic | Synthetic | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | Inteacting with microbial membrane | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25681127 | |
antitb_1528 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 37 | L | Cationic | Protein derived | Derived from Human cationic antimicrobial protein 18 (hCAP18) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 2.1 μg/ml | in vitro | Human macrophage THP1 | NA | No cytotoxicity | C57BL/6 Mice | NA | Induce expression of IL-8 and MCP-1 | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria | Bacterial cell membrane | NA | NA | 2015 | 25613372 |
antitb_1529 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 18 | L | Cationic | Protein derived | Derived from Human cationic antimicrobial protein 18 (hCAP18) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 25 μg/ml | in vitro | Human macrophage THP1 | NA | No cytotoxicity | NA | NA | Induce expression of IL-8 and MCP-1 | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria | Bacterial cell membrane | NA | NA | 2015 | 25613372 |
antitb_1530 | D5 | KWKSFLKTFKSLKKTKLHTLLKLISS | Acetylation | Amidation | None | Linear | 27 | L | Cationic | Protein derived | Derived from Human cationic antimicrobial protein 18 (hCAP18) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 35.2 μg/ml | in vitro | Human macrophage THP1 | NA | No cytotoxicity | NA | NA | Induce expression of IL-8and MCP-1 | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria | Bacterial cell membrane | NA | NA | 2015 | 25613372 |
antitb_1531 | D5 | KWKSFLKTFKSLKKTKLHTLLKLISS | Acetylation | Amidation | None | Linear | 27 | L | Cationic | Protein derived | Derived from Human cationic antimicrobial protein 18 (hCAP18) | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR-TB | MIC = 49 μg/ml | in vitro | Human macrophage THP1 | NA | No cytotoxicity | NA | NA | Induce expression of IL-8and MCP-1 | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria | Bacterial cell membrane | NA | NA | 2015 | 25613372 |
antitb_1532 | G13 | QRSVSNAATRVCRTGRSRW | Free | Free | None | Linear | 19 | L | Cationic | Protein derived | Derived from human granulysin protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
antitb_1533 | GranF2 | VCRTGRSRWRDVNRNFMRRYQSR | Free | Free | None | Linear | 23 | L | Cationic | Protein derived | Derived from human granulysin protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
antitb_1534 | Proregion | SVFPQQTTGQLAELQPQDRAGARASWMPMFQRRRRR | Free | Free | None | Linear | 36 | L | Cationic | Protein derived | Derived from Hepcidin protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | induce expression of IFN-γ | Cause structural damage to mycobacteria | NA | NA | NA | 2015 | 25613372 |
antitb_1535 | Human neutrohil peptide (HNP-1) | DCYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 2.5 μg/ml | in vitro | NA | NA | No cytotoxicity | NA | NA | Mediate macrophage to induce TNF-α expression | Inhibit lipid biosynthesi | NA | NA | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25613372 |
antitb_1536 | Human neutrohil peptide (HNP-1) | DCYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50=0.0375 μg/ml | in vitro | NA | NA | NA | NA | NA | Mediate macrophage to induce TNF-α expression | Inhibit lipid biosynthesi | NA | HNP-1 + Rifampicin | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25613372 |
antitb_1537 | Human neutrohil peptide (HNP-1) | DCYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50= 0.0255 μg/ml | in vitro | NA | NA | NA | NA | NA | Mediate macrophage to induce TNF-α expression | Inhibit lipid biosynthesi | NA | HNP-1 + Isoniazid | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas | 2015 | 25613372 |
antitb_1538 | HCL2 | ESTYQGHHTPPVQKGLRYGIILFITSEVFFFAGFF | Free | Free | None | Linear | 35 | L | Cationic | Protein derived | Derived from Cytochrome C oxidase subunit 3 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | Human macrophage THP1 | NA | No cytotoxicity | NA | NA | NA | Disrupt interaction between ESAT-6 and CFP10 | bacterial ESAT-6 | NA | NA | 2015 | 25613372 |
antitb_1539 | MIAP | GIGKFLKSKGKFGKA | Free | Free | None | Linear | 15 | L | Cationic | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 300 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
antitb_1540 | Ub2 | STLHLVLRLRGG | Free | Free | None | Linear | 12 | L | Cationic | Protein derived | Derived from human ubiquitin protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Disrupt the mycobacterial membrane | NA | NA | Bactericidal against pseudomonas and staphylococcus at pH 5.5 | 2015 | 25613372 |
antitb_1541 | RNase3 | RPPQFTRAQWFAIQHISLMPPRCTIAMRAINNYRWRCKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein derived | Derived from eisinophilic cationic protein (ECP) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 20 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Disrupt the mycobacterial membrane | NA | NA | Bactericidal against pseudomonas and staphylococcus at pH 5.5 | 2015 | 25613372 |
antitb_1542 | RNAse7 | RPPQFTRAQWFAIQHISLMPPRCTIAMRAINNYRWRCKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein derived | Derived from eisinophilic cationic protein (ECP) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Disrupt the mycobacterial membrane | NA | NA | Bactericidal against pseudomonas and staphylococcus at pH 5.5 | 2015 | 25613372 |
antitb_1543 | RNAse7 | RPPQFTRAQWFAIQHISLMPPRCTIAMRAINNYRWRCKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein derived | Derived from eisinophilic cationic protein (ECP) | Mycobacterium vaccae | Mycobacterium vaccae | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Disrupt the mycobacterial membrane | NA | NA | Bactericidal against pseudomonas and staphylococcus at pH 5.5 | 2015 | 25613372 |
antitb_1544 | Hepcidin | DTHFPICIFCCGCCHRSKCGMCCKT | Free | Free | None | Linear | 25 | L | Cationic | Protein derived | Derived from Hepcidin protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | induce expression of IFN-γ | Cause structural damage to mycobacteria | NA | NA | NA | 2015 | 25613372 |
antitb_1545 | D-LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 14.4 μg/ml | in vitro | NA | NA | NA | NA | NA | induce expression of IFN-γ | Cause structural damage to mycobacteria | NA | NA | NA | 2015 | 25613372 |
antitb_1549 | NisinA | I-(Dhb)-A-I-D-L-A-(Dha)-P-G-A-K-(Abu)-G-A-L-M-G-A-N-M-K-(Abu)-A-(Abu)-A-N-S-I-H-V-(Dha)-L | Free | Free | Dha= Didehydroalanine, Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid | Linear | 33 | L | Cationic | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 60 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
antitb_1550 | Lacticin 3147 | AA-(Dhb)-N-(Dhb)-FALADYWGNNGAWA-(Abu)-L-(Abu)-HEAMAWAK | Free | Free | Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid | Linear | 30 | L | Cationic | Natural | Derived from Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | IC90= 7.5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
antitb_1551 | Lacticin 3147 | AA-(Dhb)-N-(Dhb)-FALADYWGNNGAWA-(Abu)-L-(Abu)-HEAMAWAK | Free | Free | Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid | Linear | 30 | L | Cationic | Natural | Derived from Lactococcus lactis | Mycobacterium avium | Mycobacterium avium | IC90= 60 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
antitb_1552 | Lacticin 3147 | AA-(Dhb)-N-(Dhb)-FALADYWGNNGAWA-(Abu)-L-(Abu)-HEAMAWAK | Free | Free | Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid | Linear | 30 | L | Cationic | Natural | Derived from Lactococcus lactis | Mycobacterium Kansaii | Mycobacterium Kansaii | IC90= 15 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
antitb_1553 | E50-52 | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from Enterococcus faecalis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 0.1mg/L (within macrophage) | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
antitb_1554 | E50-52 | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from Enterococcus faecalis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 1μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
antitb_1555 | Pk34 | PRVIETKVHGREVTGLARNVSEENVDRLAKRWIK | Free | Free | None | Linear | 34 | L | Cationic | Mycobacteriophage derived | Derived from mycobacteriophage | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50= 50 μg/ml | in vitro | NA | NA | Macrophage like J774A.1 cell line | BALB/C mice | 20mg/Kg | Increase production of cytokine like IFN-γ,TNF-α,IL-12,MCp-1, IL-10, IL-6 | NA | NA | NA | Bactericidal against E.coli, pseudomonas, S.aureus, Bacillus subtilis | 2015 | 25613372 |
antitb_1556 | 1-C134mer | H-Ntridec-Nlys-Nspe-Nspe-Nlys_NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nssb = (S)-N-(sec-butyl)glycine | NA | 5 | L | Cationic | NA | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 6.3 μg/ml | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
antitb_1557 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH) DR-i | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2003 | 12927960 |
antitb_1558 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif) DR-ir | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2004 | 12927960 |
antitb_1559 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Streptomycin) DR-is | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2005 | 12927960 |
antitb_1560 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Streptomycin) DR-is | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2006 | 12927960 |
antitb_1561 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif+Streptomycin) DR-irs | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2007 | 12927960 |
antitb_1562 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif+Streptomycin+ehambutol) DR-irse | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2008 | 12927960 |
antitb_1563 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.20 ± 0.15 at peptide concentration 64μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1564 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.70 ± 0.15 at peptide concentration 64μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1565 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 0.88± 0.30 at peptide concentration 4 μg/ml +INH 0.06 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH +peptide | NA | 2004 | 15245864 |
antitb_1566 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.19 ± 0.15 at peptide concentration 64 μg/ml +INH 0.06 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH+Peptide | NA | 2004 | 15245864 |
antitb_1567 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.19 ± 0.15 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1568 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.58 ± 0.47 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1569 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.16 ± 0.21 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1570 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.97 ± 0.40 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1571 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.70 ± 0.10 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1572 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 1.72 ± 0.46 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1573 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 3.08 ± 0.09 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1574 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 19 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM23 | CFU/well 2.97 ± 0.06 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1575 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 20 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM24 | CFU/well 3.11 ± 0.09 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |