Primary information |
---|
ID | antitb_1535 |
Peptide Name | Human neutrohil peptide (HNP-1) |
Sequence | DCYCRIPACIAGERRYGTCIYQGRLWAFCC |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
Linear/ Cyclic | Cyclic |
Length | 30 |
Chirality | L |
Nature | Cationic |
Source | Natural |
Origin | Human neutrophil |
Species | Mycobacterium tuberculosis |
Strain | Mycobacterium tuberculosis H37Rv |
Inhibition Concentartion | 2.5 μg/ml |
In vitro/In vivo | in vitro |
Cell Line | NA |
Inhibition Concentartion | NA |
Cytotoxicity | No cytotoxicity |
In vivo Model | NA |
Lethal Dose | NA |
Immune Response | Mediate macrophage to induce TNF-α expression |
Mechanism of Action | Inhibit lipid biosynthesi |
Target | NA |
Combination Therapy | NA |
Other Activities | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas |
Pubmed ID | 25613372 |
Year of Publication | 2015 |
3-D Structure | NA |