Primary information |
---|
ID | antitb_1558 |
Peptide Name | Vgf-1 |
Sequence | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Length | 59 |
Chirality | L |
Nature | NA |
Source | Natural |
Origin | Derived from snake venom N.atra |
Species | Mycobacterium tuberculosis |
Strain | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif) DR-ir |
Inhibition Concentartion | MIC = 8.5 ± 0.1 mg/L |
In vitro/In vivo | in vitro |
Cell Line | NA |
Inhibition Concentartion | NA |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other Activities | NA |
Pubmed ID | 12927960 |
Year of Publication | 2004 |
3-D Structure | View in Jmol or Download Structure |