Primary information |
---|
ID | antitb_1528 |
Peptide Name | LL-37 |
Sequence | [LL-37, 37 aa] |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Length | 37 |
Chirality | L |
Nature | Cationic |
Source | Protein derived |
Origin | Derived from Human cationic antimicrobial protein 18 (hCAP18) |
Species | Mycobacterium tuberculosis |
Strain | Mycobacterium tuberculosis H37Rv |
Inhibition Concentartion | MIC = 2.1 μg/ml |
In vitro/In vivo | in vitro |
Cell Line | Human macrophage THP1 |
Inhibition Concentartion | NA |
Cytotoxicity | No cytotoxicity |
In vivo Model | C57BL/6 Mice |
Lethal Dose | NA |
Immune Response | Induce expression of IL-8 and MCP-1 |
Mechanism of Action | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria |
Target | Bacterial cell membrane |
Combination Therapy | NA |
Other Activities | NA |
Pubmed ID | 25613372 |
Year of Publication | 2015 |
3-D Structure | View in Jmol or Download Structure |