| Primary information |
|---|
| ID | antitb_1528 |
| Peptide Name | LL-37 |
| Sequence | [LL-37, 37 aa] |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 37 |
| Chirality | L |
| Nature | Cationic |
| Source | Protein derived |
| Origin | Derived from Human cationic antimicrobial protein 18 (hCAP18) |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis H37Rv |
| Inhibition Concentartion | MIC = 2.1 μg/ml |
| In vitro/In vivo | in vitro |
| Cell Line | Human macrophage THP1 |
| Inhibition Concentartion | NA |
| Cytotoxicity | No cytotoxicity |
| In vivo Model | C57BL/6 Mice |
| Lethal Dose | NA |
| Immune Response | Induce expression of IL-8 and MCP-1 |
| Mechanism of Action | In vitro binding of bacterilamembrane and induce pore formation while in vivo activate TLR and monocyte to kill bacteria |
| Target | Bacterial cell membrane |
| Combination Therapy | NA |
| Other Activities | NA |
| Pubmed ID | 25613372 |
| Year of Publication | 2015 |
| 3-D Structure |  View in Jmol or Download Structure |