| Primary information |
|---|
| ID | antitb_1524 |
| Peptide Name | NK-Lysin |
| Sequence | NEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKD |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 36 |
| Chirality | L |
| Nature | Cationic |
| Source | Synthetic |
| Origin | NA |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis H37Rv |
| Inhibition Concentartion | Reduction in bacterial growth inhibiton to 60% at conc. Of 9.37 mg/L |
| In vitro/In vivo | in vitro |
| Cell Line | NA |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | Inteacting with microbial membrane |
| Target | NA |
| Combination Therapy | NA |
| Other Activities | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas |
| Pubmed ID | 25681127 |
| Year of Publication | 2015 |
| 3-D Structure |  View in Jmol or Download Structure |