| Primary information |
|---|
| ID | antitb_1292, |
| Name | 17347179 |
| N-Terminal modification | Bcn5 |
| C-Terminal Modification | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 39 |
| Source | L |
| Species | Natural |
| Strain | Isolated from diverse Gram-positive bacteria species |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis strain H37Rv |
| Inhibition Concentration | Both |
| Sequence | 2007 |
| Cytotoxicity | Mouse macrophages |
| In vivo Model | No inhibition |
| Lethal Dose | No cytotoxicty |
| Immune Responce | C57BL/6JCit (B6) feamale mice of age 15 |
| Mechanism of Action | 10 mg/mouse of Bcn5-PhC complex |
| Target | NA |
| Combination Therapy | Formation of pores in cell membranes |
| Other activities | Cell envelope |
| PMID | Mixture of phosphatidylcholine (Ph) and cardiolipin (C) with Bcn5 |
| Year of Publication | None |
Tertiary Structure
(Technique) | Not Predicted), |
| Primary information |
|---|
| ID | antitb_1553, |
| Name | 25613372 |
| N-Terminal modification | E50-52 |
| C-Terminal Modification | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 39 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from Enterococcus faecalis |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | MIC= 0.1mg/L (within macrophage) |
| Inhibition Concentration | in vitro |
| Sequence | 2015 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
Tertiary Structure
(Technique) | Not Predicted), |
| Primary information |
|---|
| ID | antitb_1554, |
| Name | 25613372 |
| N-Terminal modification | E50-52 |
| C-Terminal Modification | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 39 |
| Source | L |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from Enterococcus faecalis |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | MIC = 1μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2015 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
Tertiary Structure
(Technique) | Not Predicted), |