| Primary information |
|---|
| ID | antitb_1292 |
| Peptide Name | Bcn5 |
| Sequence | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 39 |
| Chirality | L |
| Nature | NA |
| Source | Natural |
| Origin | Isolated from diverse Gram-positive bacteria species |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis strain H37Rv |
| Inhibition Concentartion | NA |
| In vitro/In vivo | Both |
| Cell Line | Mouse macrophages |
| Inhibition Concentartion | No inhibition |
| Cytotoxicity | No cytotoxicty |
| In vivo Model | C57BL/6JCit (B6) feamale mice of age 15 |
| Lethal Dose | 10 mg/mouse of Bcn5-PhC complex |
| Immune Response | NA |
| Mechanism of Action | Formation of pores in cell membranes |
| Target | Cell envelope |
| Combination Therapy | Mixture of phosphatidylcholine (Ph) and cardiolipin (C) with Bcn5 |
| Other Activities | None |
| Pubmed ID | 17347179 |
| Year of Publication | 2007 |
| 3-D Structure |  View in Jmol or Download Structure |