Primary information |
---|
ID | antitb_1554 |
Peptide Name | E50-52 |
Sequence | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Length | 39 |
Chirality | L |
Nature | Cationic |
Source | Natural |
Origin | Derived from Enterococcus faecalis |
Species | Mycobacterium tuberculosis |
Strain | Mycobacterium tuberculosis H37Rv |
Inhibition Concentartion | MIC = 1μg/ml |
In vitro/In vivo | in vitro |
Cell Line | NA |
Inhibition Concentartion | NA |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other Activities | NA |
Pubmed ID | 25613372 |
Year of Publication | 2015 |
3-D Structure | View in Jmol or Download Structure |