Welcome to Peptide Card of AntiTbPdb
| This page displays user query in tabular form. |
ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG details |
| Primary information | |
|---|---|
| ID | antitb_1557, |
| Name | 12927960 |
| N-Terminal modification | Vgf-1 |
| C-Terminal Modification | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 59 |
| Source | L |
| Species | Natural |
| Strain | Derived from snake venom N.atra |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH) DR-i |
| Cell Line | MIC = 8.5 ± 0.1 mg/L |
| Inhibition Concentration | in vitro |
| Sequence | 2003 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1558, |
| Name | 12927960 |
| N-Terminal modification | Vgf-1 |
| C-Terminal Modification | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 59 |
| Source | L |
| Species | Natural |
| Strain | Derived from snake venom N.atra |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif) DR-ir |
| Cell Line | MIC = 8.5 ± 0.1 mg/L |
| Inhibition Concentration | in vitro |
| Sequence | 2004 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1559, |
| Name | 12927960 |
| N-Terminal modification | Vgf-1 |
| C-Terminal Modification | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 59 |
| Source | L |
| Species | Natural |
| Strain | Derived from snake venom N.atra |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Streptomycin) DR-is |
| Cell Line | MIC = 8.5 ± 0.1 mg/L |
| Inhibition Concentration | in vitro |
| Sequence | 2005 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1560, |
| Name | 12927960 |
| N-Terminal modification | Vgf-1 |
| C-Terminal Modification | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 59 |
| Source | L |
| Species | Natural |
| Strain | Derived from snake venom N.atra |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Streptomycin) DR-is |
| Cell Line | MIC = 8.5 ± 0.1 mg/L |
| Inhibition Concentration | in vitro |
| Sequence | 2006 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1561, |
| Name | 12927960 |
| N-Terminal modification | Vgf-1 |
| C-Terminal Modification | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 59 |
| Source | L |
| Species | Natural |
| Strain | Derived from snake venom N.atra |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif+Streptomycin) DR-irs |
| Cell Line | MIC = 8.5 ± 0.1 mg/L |
| Inhibition Concentration | in vitro |
| Sequence | 2007 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |
| Primary information | |
|---|---|
| ID | antitb_1562, |
| Name | 12927960 |
| N-Terminal modification | Vgf-1 |
| C-Terminal Modification | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 59 |
| Source | L |
| Species | Natural |
| Strain | Derived from snake venom N.atra |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif+Streptomycin+ehambutol) DR-irse |
| Cell Line | MIC = 8.5 ± 0.1 mg/L |
| Inhibition Concentration | in vitro |
| Sequence | 2008 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | NA |
| PMID | NA |
| Year of Publication | NA |
| Tertiary Structure (Technique) | Not Predicted), |