Browse result page of AntiTbPdb
The total number entries retrieved from this search are 771
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1576 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 21 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM25 | CFU/well 3.19 ± 0.05 at peptide concentration 4 μg/ml +INH 4μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1577 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 22 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM26 | CFU/well 3.08 ± 0.09 at peptide concentration 64 μg/ml +INH 4μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1578 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 3.10 ± 0.08 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1579 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 3.00 ± 0.10 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1580 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 3.05 ± 0.11 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1581 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.88 ± 0.06at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1582 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.71 ± 0.09 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1583 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.11 ± 0.10 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1584 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.15 ± 0.0.16 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1585 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 1.31 ± 0.10 at peptide concentration 4 μg/ml + INH 0.06 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | peptide +INH | NA | 2004 | 15245864 |
antitb_1586 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | peptide +INH | NA | 2004 | 15245864 |
antitb_1587 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.15 ± 0.20 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1588 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.21 ± 0.42 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1589 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.02 ± 0.30 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1590 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.991± 0.23 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1591 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.90± 0.20 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1592 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.80 ± 0.15 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1593 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.91 ± 0.19 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1594 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.89 ± 0.19 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1595 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.70 ± 0.15 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1596 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.90 ± 0.09 at peptide concentration 4 μg/ml + INH 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1597 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.91 ± 0.19 at peptide concentration 64 μg/ml + INH 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1598 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.93 ± 0.07 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH+peptide | NA | 2004 | 15245864 |
antitb_1599 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.78 ± 0.15 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH+peptide | NA | 2004 | 15245864 |
antitb_1600 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.80 ± 0.14 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1601 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.66 ± 0.15 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1602 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.60 ± 0.17 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
antitb_1603 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 0.68 ± 0.30 at peptide 64ul + 4 ul of INH | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
antitb_1604 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-14 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 1.99 ± 0.44 at peptide 64ul + 4 ul of INH | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
antitb_1605 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
antitb_1606 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 0.90 ± 0.75 at peptide 64ul + 4 ul of INH | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
antitb_1607 | TP-5 | RKDVY | Free | Amidation | None | Linear | 4 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = > 1000mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
antitb_1608 | RR-6 | RRRRRR | Free | Amidation | None | Linear | 5 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
antitb_1609 | RR-11 | RKDVYRRRRRR | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
antitb_1610 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
antitb_1611 | TP-5 | RKDVY | Free | Amidation | None | Linear | 4 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | NA | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
antitb_1612 | RR-6 | RRRRRR | Free | Amidation | None | Linear | 5 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
antitb_1613 | RR-11 | RKDVYRRRRRR | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
antitb_1614 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
antitb_1615 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | RR-11 Peptide(31.25 mg/L) + Rifampicin (1.95mg/L) | NA | 2014 | 24411680 |
antitb_1616 | LK | LLKKLLKK | Free | Amidation | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 125 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
antitb_1617 | PP | PLLKKLLKKP | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 250 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
antitb_1618 | CC | CLLKKLLKKC | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 250 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
antitb_1619 | II | ILLKKLLKKI | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
antitb_1620 | MM | MLLKKLLKKM | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
antitb_1621 | WW | WLLKKLLKKW | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
antitb_1622 | LK | LLKKLLKK | Free | Amidation | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
antitb_1623 | PP | PLLKKLLKKP | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 125 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
antitb_1624 | CC | CLLKKLLKKC | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 250 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
antitb_1625 | II | ILLKKLLKKI | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 15.6 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |