Browse result page of AntiTbPdb
The total number entries retrieved from this search are 771
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1626 | MM | MLLKKLLKKM | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 15.6 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1627 | WW | WLLKKLLKKW | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 0.98 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1628 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 37 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacteria smegmatis mc2 155 | MIC = 2400 μg/ml | in vitro | J774 macrophage cell lines | NA | IC50= 11226 μg/ml | NA | NA | Stimulation of TNF-α production | inhibit bacterial Atpase activity | NA | NA | NA | 2015 | 26218806 |
| antitb_1629 | LLAP | RKSAKKIGKRAKR | Free | Free | None | Linear | 13 | L | Cationic | Natural | NA | Mycobacterium smegmatis | Mycobacteria smegmatis mc2 155 | MIC = 600 μg/ml | in vitro | J774 macrophage cell lines | NA | IC50= 11226 μg/ml | NA | NA | Stimulation of TNF-α production | inhibit bacterial Atpase activity | NA | NA | NA | 2015 | 26218806 |
| antitb_1648 | Tuftsin peptide conjugate compound | EFAGAGFVRAGAL | INH is conjugated | Free | None | Cyclic | 13 | L | Cationic | Natural | Derived from 16-kDa protein of M. tuberculosis and tuftsin-derived peptides | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 27294 | MIC = 2.52 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Cell wall biosynthesis inhibition | NA | Peptide + INH(0.24 ug/ml) | NA | 2009 | 19319854 |
| antitb_1649 | Tuftsin peptide conjugate compound | SEFAYGSFVRTVSLPV | INH is conjugated | Free | None | Cyclic | 16 | L | Cationic | Natural | Derived from 16-kDa protein of M. tuberculosis and tuftsin-derived peptides | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 27294 | MIC = 2.54 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Cell wall biosynthesis inhibition | NA | Peptide + INH(0.24 ug/ml) | NA | 2009 | 19319854 |
| antitb_1650 | Tuftsin peptide conjugate compound | SEFAYGSFVRTVSLPV | INH is conjugated | Free | None | Cyclic | 16 | L | Cationic | Natural | Derived from 16-kDa protein of M. tuberculosis and tuftsin-derived peptides | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 27294 | MIC = 2.26μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Cell wall biosynthesis inhibition | NA | Peptide + INH(0.24 ug/ml) | NA | 2009 | 19319854 |
| antitb_1651 | Human neutrohil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Synthetic | Human neutrophil | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC50 = 0.8μg/ml | in vitro | murine macrophage-like cell line J744A.1 | NA | cytotoxic at above concentration 5 ug/ml | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2016 | 10933095 |
| antitb_1652 | Human neutrohil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Synthetic | Human neutrophil | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC90 = 2.5 μg/ml | in vitro | murine macrophage-like cell line J744A.1 | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2016 | 10933095 |
| antitb_1653 | NA | WKWLKKWIK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC90 = 1.5 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2016 | 26645944 |
| antitb_1702 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 7632G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1703 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys30 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 9034G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1704 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys31 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 11170G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1708 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 7632G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1709 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-14 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 9034G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1710 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-15 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 11170G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1711 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-16 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37 Ra | IC50= 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1712 | Porcine leucocyte peptide (PG-1) | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-17 | Cyclic | 18 | L | Cationic | Natural | porcine neutrophil leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37 Ra | MIC = 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
| antitb_1713 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5123 | Mycobacterium tuberculosis | Mycobacterium Tuberculosis H37Rv resistant to streptomycin | IC90= < 0.20 μg/ml | Both | VERO cell line | 50 % bacteria is killed | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2014 | 25409285 |
| antitb_1714 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5124 | Mycobacterium tuberculosis | Mycobacterium Tuberculosis H37Rv resistant to rifampicin | IC90= 0.30 μg/ml | Both | VERO cell line | 51 % bacteria is killed | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2014 | 25409285 |
| antitb_1715 | Ecumicin | (N,N-Me2-Val)-(Val)-(N-Me-allo-Ilu)-(Thr)-(N-Me-Thr)-(Val)-(N-Me-Leu)-(Val)-(N-Me-Val)-(N-Me-4-OMe-Trp)-(Val)-(Ph-threo-Ser)-(Val) | Free | Free | N-methylation pattern, N-Me-Val = N-methyl-valine, N,N-Me2-Val = N,N-dimethyl-valine, N-Me-Thr = N-methyl-threonine, N-Me-Leu = N-methyl-leucine, N-Me-allo-Ilu = N-methyl-isoleucine, N-Me-4-OMe-Trp = N-methyl-4-methoxy-tryptophan, Ph-threo-Ser = Phe | Macrocyclic | 13 | L | NA | Natural | Produced by a genetically distinct Nonomuraea species, strain MJM5125 | Mycobacterium tuberculosis | Mycobacterium Tuberculosis H37Rv resistant to cycloserine | IC90= < 0.20μg/ml | Both | VERO cell line | 52 % bacteria is killed | No cytotoxicity | NA | NA | NA | NA | NA | NA | NA | 2014 | 25409285 |
| antitb_1716 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in CFU at 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1717 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1718 | Human neutrophil peptide (HNP-2) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys1-cys29, cys3-cys18,cys8-cys28 | 29 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in bacterial load to 64 % at 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 | |
| antitb_1719 | Human neutrophil peptide (HNP-3) | DCYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 25291 | Reduction in bacterial load to 61 % 5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 | |
| antitb_1720 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain SJB | Reduction in CFU/well 91.8 ± 1.1 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1721 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 292524 | Reduction in CFU/well70.6 ± 0.6 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1722 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium avium- mycobacterium intracellularae | Mycobacterium avium- mycobacterium intracellularae strain 475049 | Reduction in CFU/well 32.5 ± 10.7 at peptide concentration 50μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 1992 | 1398982 |
| antitb_1723 | SEQ ID NO 3 | NVTSIHSLL | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1724 | SEQ ID NO 4 | ELNNALQNLART | Free | Free | None | Linear | 12 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1725 | SEQ ID NO 7 | SGSEAYQGVQQKWDA | Free | Free | None | Linear | 15 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1726 | SEQ ID NO 8 | TATELNNAL | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1727 | SEQ ID NO 9 | RTISEAGQAM | Free | Free | None | Linear | 10 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1728 | SEQ ID NO 10 | AYQGVQQKW | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1729 | SEQ ID NO 11 | SEAYQGVQQ | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1730 | SEQ ID NO 12 | SEAYQGVQQK | Free | Free | None | Linear | 10 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1731 | Seq ID No 10 | KMHATNHGGGS | Free | Free | None | Linear | 11 | L | NA | Synthetic | From random peptide libraries diplayed on bacteriophage M13 | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 100 μM completely inhibits the cahpaeron activity of Hsp 16.3 | In vitro | Mouse bone marrow derive dmacrophages and THP-1 | NA | NA | None | NA | NA | Inhibit chaperon activity of heat shock protein 16.3 (Hsp 16.3) | Heat shock protein (Hsp 16.3) | None | None | 2007 | US 2007/003721 |
| antitb_1732 | Seq ID No 22 | YPHHFKHRHIPIGGGS | Free | Free | None | Linear | 16 | L | NA | Synthetic | From random peptide libraries diplayed on bacteriophage M14 | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 100 μM completely inhibits the cahpaeron activity of Hsp 16.3 | In vitro | Mouse bone marrow derive dmacrophages and THP-1 | NA | NA | None | NA | NA | Inhibit chaperon activity of heat shock protein 16.3 (Hsp 16.3) | Heat shock protein (Hsp 16.3) | None | None | 2007 | US 2007/003721 |
| antitb_1733 | Seq ID No 1 | GVENVSW | Free | Free | None | Linear | 7 | L | NA | Synthetic | From random peptide libraries diplayed on bacteriophage M15 | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 100 μM completely inhibits the cahpaeron activity of Hsp 16.3 | In vitro | Mouse bone marrow derive dmacrophages and THP-1 | NA | NA | None | NA | NA | Inhibit chaperon activity of heat shock protein 16.3 (Hsp 16.3) | Heat shock protein (Hsp 16.3) | None | None | 2007 | US 2007/003721 |
| antitb_1734 | Seq ID No 2 | KMHATNH | Free | Free | None | Linear | 7 | L | NA | Synthetic | From random peptide libraries diplayed on bacteriophage M16 | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 100 μM completely inhibits the cahpaeron activity of Hsp 16.3 | In vitro | Mouse bone marrow derive dmacrophages and THP-1 | NA | NA | None | NA | NA | Inhibit chaperon activity of heat shock protein 16.3 (Hsp 16.3) | Heat shock protein (Hsp 16.3) | None | None | 2007 | US 2007/003721 |
| antitb_1735 | Seq ID No 9 | KMHATNHGGGS | Free | Free | None | Linear | 11 | L | NA | Synthetic | From random peptide libraries diplayed on bacteriophage M17 | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 100 μM completely inhibits the cahpaeron activity of Hsp 16.3 | In vitro | Mouse bone marrow derive dmacrophages and THP-1 | NA | NA | None | NA | NA | Inhibit chaperon activity of heat shock protein 16.3 (Hsp 16.3) | Heat shock protein (Hsp 16.3) | None | None | 2007 | US 2007/003721 |
| antitb_1736 | Seq ID No 21 | YPHHFKHRHIPI | Free | Free | None | Linear | 12 | L | NA | Synthetic | From random peptide libraries diplayed on bacteriophage M18 | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 100 μM completely inhibits the cahpaeron activity of Hsp 16.3 | In vitro | Mouse bone marrow derive dmacrophages and THP-1 | NA | NA | None | NA | NA | Inhibit chaperon activity of heat shock protein 16.3 (Hsp 16.3) | Heat shock protein (Hsp 16.3) | None | None | 2007 | US 2007/003721 |
| antitb_1737 | FKAB-1F | KL-Tic-Oic-K-Tic-Oic-F-Tic-Oic-K-Tic-Oic-F-Tic-Oic-K-Tic-Oic-KR | Free | Amidation | Tic = tetrahydroisoquinolinecarboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 21 | L | Hydrophobic | Synthetic | NA | Mycobacterium ranae | Mycobacterium ranae | MIC = 30 μM | Both | RBC | NA | 63 % hemolysis at 100 and 25 μM | Mice | NA | NA | NA | NA | None | Anti-bacterial (Salmonella typhimurium, Staphylococcus aureus, Bacillus subtillis) | 2012 | US 2012/0197004 |
| antitb_1738 | FKAB-1G | GF-Tic-Oic-GK-Tic-Oic-GF-Tic-Oic-GK-Tic-KKKK | Acetylation | Amidation | Tic = tetrahydroisoquinolinecarboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 19 | L | Hydrophobic | Synthetic | NA | Mycobacterium ranae | Mycobacterium ranae | MIC = 10 μM | Both | RBC | NA | 14 % hemolysis at 100 and 25 μM | Mice | No observed toxicity at 5 and 25 mg/kg but minor | NA | NA | NA | None | Anti-bacterial (Salmonella typhimurium, Staphylococcus aureus, Bacillus subtillis) | 2012 | US 2012/0197004 |
| antitb_1739 | FKAB-1H | GF-Tic-Oic-GK-Tic-Oic-GF-Tic-Oic-GK-Tic-KKKK | Acetylation | Addition of CONH-CH2-CH2-NH2 | Tic = tetrahydroisoquinolinecarboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 19 | L | Hydrophobic | Synthetic | NA | Mycobacterium ranae | Mycobacterium ranae | MIC = 10 μM | Both | RBC | NA | NA | Mice | NA | NA | NA | NA | None | Anti-bacterial (Salmonella typhimurium, Staphylococcus aureus, Bacillus subtillis) | 2012 | US 2012/0197004 |
| antitb_1740 | FKAB-1L | GF-Tic-Oic-GK-Tic-Oic-GF-Tic-Oic-GK-Tic-KKKK | Acetylation | Addition of CONH-CH2-CH2-CH2-NH2 | Tic = tetrahydroisoquinolinecarboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 19 | L | Hydrophobic | Synthetic | NA | Mycobacterium ranae | Mycobacterium ranae | MIC = 10 μM | Both | RBC | NA | NA | Mice | NA | NA | NA | NA | None | Anti-bacterial (Salmonella typhimurium, Staphylococcus aureus, Bacillus subtillis) | 2012 | US 2012/0197004 |
| antitb_1741 | FKAB-1Ga | G-GF-Tic-Oic-GK-Tic-Oic-GF-Tic-Oic-GK-Tic-KKKK | Free | Amidation | Tic = tetrahydroisoquinolinecarboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 20 | L | Hydrophobic | Synthetic | NA | Mycobacterium ranae | Mycobacterium ranae | MIC = 10 μM | Both | RBC | NA | 33.4 % hemolysis at 100 μM and 14.3 % at 25 μM | Mice | NA | NA | NA | NA | None | Anti-bacterial (Salmonella typhimurium, Staphylococcus aureus, Bacillus subtillis) | 2012 | US 2012/0197004 |
| antitb_1742 | FKAB-1Gb | G-KL-Tic-Oic-GK-Tic-Oic-GF-Tic-Oic-GK-Tic-KKKK | Free | Amidation | Tic = tetrahydroisoquinolinecarboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 20 | L | Hydrophobic | Synthetic | NA | Mycobacterium ranae | Mycobacterium ranae | MIC = 3 μM | Both | RBC | NA | 43.6 % hemolysis at 100 μM and 24.9 % at 25 μM | Mice | No observed toxicity at 1, 5 and 25 mg/kg | NA | NA | NA | None | Anti-bacterial (Salmonella typhimurium, Staphylococcus aureus, Bacillus subtillis) | 2012 | US 2012/0197004 |
| antitb_1743 | FKAB-1Gc | F-Tic-Oic-K-Tic-Oic-F-Tic-Oic-K-Tic-KKKK | Acetylation | Amidation | Tic = tetrahydroisoquinolinecarboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 15 | L | Hydrophobic | Synthetic | NA | Mycobacterium ranae | Mycobacterium ranae | MIC = 30 μM | Both | RBC | NA | 86.8 % hemolysis at 100 μM and 50 % at 25 μM | Mice | Minor weight loss, no observed toxicity at 1, 5 an | NA | NA | NA | None | Anti-bacterial (Salmonella typhimurium, Staphylococcus aureus, Bacillus subtillis) | 2012 | US 2012/0197004 |
| antitb_1744 | FKAB-1Gd | Gaba-F-Tic-Oic-Gaba-K-Tic-Oic-Gaba-F-Tic-Oic-Gaba-K-Tic-KKKK | Acetylation | Amidation | Gaba = Gama aminobutyric acid, Tic = tetrahydroisoquinolinecarboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 19 | L | Hydrophobic | Synthetic | NA | Mycobacterium ranae | Mycobacterium ranae | MIC = 10 μM | Both | RBC | NA | 10.8 % hemolysis at 100 μM and 1.0 % at 25 μM | Mice | Minor weight loss, no observed toxicity at 1, 5 an | NA | NA | NA | None | Anti-bacterial (Salmonella typhimurium, Staphylococcus aureus, Bacillus subtillis) | 2012 | US 2012/0197004 |