| Primary information |
|---|
| ID | antitb_1628 |
| Peptide Name | LL-37 |
| Sequence | [LL-37, 37 aa] |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 37 |
| Chirality | L |
| Nature | Cationic |
| Source | Synthetic |
| Origin | NA |
| Species | Mycobacterium smegmatis |
| Strain | Mycobacteria smegmatis mc2 155 |
| Inhibition Concentartion | MIC = 2400 μg/ml |
| In vitro/In vivo | in vitro |
| Cell Line | J774 macrophage cell lines |
| Inhibition Concentartion | NA |
| Cytotoxicity | IC50= 11226 μg/ml |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | Stimulation of TNF-α production |
| Mechanism of Action | inhibit bacterial Atpase activity |
| Target | NA |
| Combination Therapy | NA |
| Other Activities | NA |
| Pubmed ID | 26218806 |
| Year of Publication | 2015 |
| 3-D Structure |  View in Jmol or Download Structure |