Primary information |
---|
ID | antitb_1651 |
Peptide Name | Human neutrohil peptide (HNP-1) |
Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
Linear/ Cyclic | Cyclic |
Length | 30 |
Chirality | L |
Nature | Cationic |
Source | Synthetic |
Origin | Human neutrophil |
Species | Mycobacterium Tuberculosis |
Strain | Mycobacterium tuberculosis H37Rv |
Inhibition Concentartion | IC50 = 0.8μg/ml |
In vitro/In vivo | in vitro |
Cell Line | murine macrophage-like cell line J744A.1 |
Inhibition Concentartion | NA |
Cytotoxicity | cytotoxic at above concentration 5 ug/ml |
In vivo Model | NA |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | Microbial membrane disruption |
Target | NA |
Combination Therapy | NA |
Other Activities | NA |
Pubmed ID | 10933095 |
Year of Publication | 2016 |
3-D Structure | NA |