Primary information |
---|
ID | antitb_1703 |
Peptide Name | Human neutrophil peptide (HNP-1) |
Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys30 |
Linear/ Cyclic | Cyclic |
Length | 30 |
Chirality | L |
Nature | Cationic |
Source | Natural |
Origin | Human neutrophil |
Species | Mycobacterium tuberculosis |
Strain | Mycobacterium tuberculosis Ra 9034G |
Inhibition Concentartion | Reduction in CFU at 50 μg/ml |
In vitro/In vivo | in vitro |
Cell Line | NA |
Inhibition Concentartion | NA |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | Microbial membrane disruption |
Target | NA |
Combination Therapy | NA |
Other Activities | NA |
Pubmed ID | 8641802 |
Year of Publication | 1996 |
3-D Structure | NA |