Primary information |
---|
ID | antitb_1133, |
Name | 11328767 |
N-Terminal modification | Human neutrophil defensin (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Internal disulphide bond (cys2-cys30, cys4-cys19,cys9-cys29) |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Protein Derived |
Strain | From the human defensin protein found in granules of neutrophils. |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain |
Cell Line | 50 mg/L causes approx 30 % growth inhibition |
Inhibition Concentration | In vitro |
Sequence | 2001 |
Cytotoxicity | None |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | None |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Disrupt the membrane architecture |
Other activities | Cell envelope |
PMID | None |
Year of Publication | Antibacterial against salmonella, staphylococcus and neisseria |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1223, |
Name | 23827033 |
N-Terminal modification | Human neutrophil peptide 1 (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulfide bridge: 2-30, 4-19, 9-29 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Species | Protein Derived |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | 96.5 % inhibition at 10 μg/ml |
Inhibition Concentration | In vitro |
Sequence | 2013 |
Cytotoxicity | THP-1 cells |
In vivo Model | Significant reduction in CFU |
Lethal Dose | NA |
Immune Responce | None |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | None |
Year of Publication | None |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1224, |
Name | 23827033 |
N-Terminal modification | Human neutrophil peptide 1 (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulfide bridge: 2-30, 4-19, 9-30 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Species | Protein Derived |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | 98.3 % inhibition at 15 μg/ml |
Inhibition Concentration | In vitro |
Sequence | 2013 |
Cytotoxicity | THP-1 cells |
In vivo Model | Significant reduction in CFU |
Lethal Dose | NA |
Immune Responce | None |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | None |
Year of Publication | None |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1225, |
Name | 23827033 |
N-Terminal modification | Human neutrophil peptide 1 (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulfide bridge: 2-30, 4-19, 9-31 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Species | Protein Derived |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | 36 Clinical isolates of Mycobacterium tuberculosis |
Cell Line | 11 isolates (31%) showed greater sensitivity to HNP-1 than H37Rv strains. At 15 μg/ml, they wer completely inhibited. |
Inhibition Concentration | In vitro |
Sequence | 2013 |
Cytotoxicity | THP-1 cells |
In vivo Model | Sixteen clinical isolates had lower intracellular growth ability than the H37Rv strain. |
Lethal Dose | NA |
Immune Responce | None |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | None |
Year of Publication | None |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1226, |
Name | 23827033 |
N-Terminal modification | Human neutrophil peptide 1 (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulfide bridge: 2-30, 4-19, 9-32 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Species | Protein Derived |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium bovis |
In Vitro/ In vivo | Mycobacterium bovis BCG |
Cell Line | 99.6 % inhibition at 10 μg/ml |
Inhibition Concentration | In vitro |
Sequence | 2013 |
Cytotoxicity | THP-1 cells |
In vivo Model | Significant reduction in CFU |
Lethal Dose | NA |
Immune Responce | None |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | None |
Year of Publication | None |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1227, |
Name | 23827033 |
N-Terminal modification | Human neutrophil peptide 1 (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulfide bridge: 2-30, 4-19, 9-33 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Species | Protein Derived |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium bovis |
In Vitro/ In vivo | Mycobacterium bovis BCG |
Cell Line | 100 % inhibition at 10 μg/ml |
Inhibition Concentration | In vitro |
Sequence | 2013 |
Cytotoxicity | THP-1 cells |
In vivo Model | Significant reduction in CFU |
Lethal Dose | NA |
Immune Responce | None |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | None |
Year of Publication | None |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1370, |
Name | 11375668 |
N-Terminal modification | Human neutrophil peptides-1 |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
Chirality | cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Synthetic |
Strain | Human neutrophils |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37 Ra |
Inhibition Concentration | in vitro |
Sequence | 2000 |
Cytotoxicity | None |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | Mycobacterial genomic DNA |
PMID | NA |
Year of Publication | antibacterial against candida albicans |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1527, |
Name | 25681127 |
N-Terminal modification | Human neutrohil peptide (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
Chirality | cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Synthetic |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Inhibition Concentration | in vitro |
Sequence | 2015 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | |
Combination Therapy | Inteacting with microbial membrane |
Other activities | NA |
PMID | NA |
Year of Publication | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1651, |
Name | 10933095 |
N-Terminal modification | Human neutrohil peptide (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Synthetic |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium Tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | IC50 = 0.8μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2016 |
Cytotoxicity | murine macrophage-like cell line J744A.1 |
In vivo Model | NA |
Lethal Dose | cytotoxic at above concentration 5 ug/ml |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Microbial membrane disruption |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1652, |
Name | 10933095 |
N-Terminal modification | Human neutrohil peptide (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Synthetic |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium Tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | IC90 = 2.5 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2016 |
Cytotoxicity | murine macrophage-like cell line J744A.1 |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Microbial membrane disruption |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1702, |
Name | 8641802 |
N-Terminal modification | Human neutrophil peptide (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis Ra 7632G |
Cell Line | Reduction in CFU at 50 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 1996 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Microbial membrane disruption |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1703, |
Name | 8641802 |
N-Terminal modification | Human neutrophil peptide (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys30 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis Ra 9034G |
Cell Line | Reduction in CFU at 50 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 1996 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Microbial membrane disruption |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1704, |
Name | 8641802 |
N-Terminal modification | Human neutrophil peptide (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys31 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis Ra 11170G |
Cell Line | Reduction in CFU at 50 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 1996 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Microbial membrane disruption |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1716, |
Name | 1398982 |
N-Terminal modification | Human neutrophil peptide (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium avium- mycobacterium intracellularae |
In Vitro/ In vivo | Mycobacterium avium- mycobacterium intracellularae strain 25291 |
Cell Line | Reduction in CFU at 5 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 1992 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1717, |
Name | 1398982 |
N-Terminal modification | Human neutrophil peptide (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium avium- mycobacterium intracellularae |
In Vitro/ In vivo | Mycobacterium avium- mycobacterium intracellularae strain 25291 |
Cell Line | Reduction in CFU at 50 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 1992 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1718, |
Name | 1398982 |
N-Terminal modification | Human neutrophil peptide (HNP-2) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys1-cys29, cys3-cys18,cys8-cys28 |
Chirality | |
Nature | 29 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium avium- mycobacterium intracellularae |
In Vitro/ In vivo | Mycobacterium avium- mycobacterium intracellularae strain 25291 |
Cell Line | Reduction in bacterial load to 64 % at 5 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 1992 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1720, |
Name | 1398982 |
N-Terminal modification | Human neutrophil peptide (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium avium- mycobacterium intracellularae |
In Vitro/ In vivo | Mycobacterium avium- mycobacterium intracellularae strain SJB |
Cell Line | Reduction in CFU/well 91.8 ± 1.1 at peptide concentration 50μg/ml |
Inhibition Concentration | in vitro |
Sequence | 1992 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1721, |
Name | 1398982 |
N-Terminal modification | Human neutrophil peptide (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium avium- mycobacterium intracellularae |
In Vitro/ In vivo | Mycobacterium avium- mycobacterium intracellularae strain 292524 |
Cell Line | Reduction in CFU/well70.6 ± 0.6 at peptide concentration 50μg/ml |
Inhibition Concentration | in vitro |
Sequence | 1992 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information |
---|
ID | antitb_1722, |
Name | 1398982 |
N-Terminal modification | Human neutrophil peptide (HNP-1) |
C-Terminal Modification | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
Chirality | Cyclic |
Nature | 30 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Human neutrophil |
Inhibition Concentration | Mycobacterium avium- mycobacterium intracellularae |
In Vitro/ In vivo | Mycobacterium avium- mycobacterium intracellularae strain 475049 |
Cell Line | Reduction in CFU/well 32.5 ± 10.7 at peptide concentration 50μg/ml |
Inhibition Concentration | in vitro |
Sequence | 1992 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |