Primary information |
---|
ID | antitb_1223 |
Peptide Name | Human neutrophil peptide 1 (HNP-1) |
Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | Disulfide bridge: 2-30, 4-19, 9-29 |
Linear/ Cyclic | Cyclic |
Length | 30 |
Chirality | L |
Nature | NA |
Source | Protein Derived |
Origin | Human neutrophil |
Species | Mycobacterium tuberculosis |
Strain | Mycobacterium tuberculosis H37Rv |
Inhibition Concentartion | 96.5 % inhibition at 10 μg/ml |
In vitro/In vivo | In vitro |
Cell Line | THP-1 cells |
Inhibition Concentartion | Significant reduction in CFU |
Cytotoxicity | NA |
In vivo Model | None |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | None |
Other Activities | None |
Pubmed ID | 23827033 |
Year of Publication | 2013 |
3-D Structure | NA |