| Primary information |
|---|
| ID | antitb_1227 |
| Peptide Name | Human neutrophil peptide 1 (HNP-1) |
| Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | Disulfide bridge: 2-30, 4-19, 9-33 |
| Linear/ Cyclic | Cyclic |
| Length | 30 |
| Chirality | L |
| Nature | NA |
| Source | Protein Derived |
| Origin | Human neutrophil |
| Species | Mycobacterium bovis |
| Strain | Mycobacterium bovis BCG |
| Inhibition Concentartion | 100 % inhibition at 10 μg/ml |
| In vitro/In vivo | In vitro |
| Cell Line | THP-1 cells |
| Inhibition Concentartion | Significant reduction in CFU |
| Cytotoxicity | NA |
| In vivo Model | None |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | None |
| Other Activities | None |
| Pubmed ID | 23827033 |
| Year of Publication | 2013 |
| 3-D Structure | NA |