| Primary information |
|---|
| ID | antitb_1132 |
| Peptide Name | Human neutrophil defensin (HNP-1) |
| Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | Internal disulphide bond (cys2-cys30, cys4-cys19,cys9-cys29) |
| Linear/ Cyclic | Cyclic |
| Length | 30 |
| Chirality | L |
| Nature | Cationic |
| Source | Protein Derived |
| Origin | From the human defensin protein found in granules of neutrophils. |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis H37Rv (ATCC 25618) |
| Inhibition Concentartion | 50 mg/L causes approx 70 % growth inhibition |
| In vitro/In vivo | In vitro |
| Cell Line | None |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | None |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | Disrupt the membrane architecture |
| Target | Cell envelope |
| Combination Therapy | None |
| Other Activities | Antibacterial against salmonella, staphylococcus and neisseria |
| Pubmed ID | 11328767 |
| Year of Publication | 2001 |
| 3-D Structure | NA |