Primary information |
---|
ID | antitb_1225 |
Peptide Name | Human neutrophil peptide 1 (HNP-1) |
Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | Disulfide bridge: 2-30, 4-19, 9-31 |
Linear/ Cyclic | Cyclic |
Length | 30 |
Chirality | L |
Nature | NA |
Source | Protein Derived |
Origin | Human neutrophil |
Species | Mycobacterium tuberculosis |
Strain | 36 Clinical isolates of Mycobacterium tuberculosis |
Inhibition Concentartion | 11 isolates (31%) showed greater sensitivity to HNP-1 than H37Rv strains. At 15 μg/ml, they wer completely inhibited. |
In vitro/In vivo | In vitro |
Cell Line | THP-1 cells |
Inhibition Concentartion | Sixteen clinical isolates had lower intracellular growth ability than the H37Rv strain. |
Cytotoxicity | NA |
In vivo Model | None |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | None |
Other Activities | None |
Pubmed ID | 23827033 |
Year of Publication | 2013 |
3-D Structure | NA |