Welcome to Peptide Card of AntiTbPdb
This page displays user query in tabular form. |
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK details |
Primary information | |
---|---|
ID | antitb_1583, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | CFU/well 3.11 ± 0.10 at peptide concentration 4 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1584, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | CFU/well 3.15 ± 0.0.16 at peptide concentration 64 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1585, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | CFU/well 1.31 ± 0.10 at peptide concentration 4 μg/ml + INH 0.06 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | peptide +INH |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1586, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | peptide +INH |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1587, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | CFU/well 3.15 ± 0.20 at peptide concentration 4 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1588, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | CFU/well 3.21 ± 0.42 at peptide concentration 8 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1589, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | CFU/well 3.02 ± 0.30 at peptide concentration 16 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1590, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | CFU/well 2.991± 0.23 at peptide concentration 32 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1591, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | CFU/well 2.90± 0.20 at peptide concentration 64 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1592, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Cell Line | CFU/well 2.80 ± 0.15 at peptide concentration 128 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1593, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
Cell Line | CFU/well 2.91 ± 0.19 at peptide concentration 4 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1594, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
Cell Line | CFU/well 2.89 ± 0.19 at peptide concentration 4 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1595, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
Cell Line | CFU/well 2.70 ± 0.15 at peptide concentration 64 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1596, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
Cell Line | CFU/well 2.90 ± 0.09 at peptide concentration 4 μg/ml + INH 4 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1597, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
Cell Line | CFU/well 2.91 ± 0.19 at peptide concentration 64 μg/ml + INH 4 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1598, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
Cell Line | CFU/well 2.93 ± 0.07 at peptide concentration 8 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | INH+peptide |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1599, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
Cell Line | CFU/well 2.78 ± 0.15 at peptide concentration 16 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | INH+peptide |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1600, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
Cell Line | CFU/well 2.80 ± 0.14 at peptide concentration 32 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1601, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
Cell Line | CFU/well 2.66 ± 0.15 at peptide concentration 64 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1602, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
Cell Line | CFU/well 2.60 ± 0.17 at peptide concentration 128 μg/ml |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | NA |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1605, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | Peptide(64 ul) + INH(4 ul) |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |
Primary information | |
---|---|
ID | antitb_1606, |
Name | 15245864 |
N-Terminal modification | β-Defensin-1(HBD-1) |
C-Terminal Modification | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. |
Chirality | Cyclic |
Nature | 36 |
Source | L |
Origin | Cationic |
Species | Natural |
Strain | Derived from beta defensin 1 OF HUMAN |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis RM22 |
Cell Line | CFU/well 0.90 ± 0.75 at peptide 64ul + 4 ul of INH |
Inhibition Concentration | in vitro |
Sequence | 2004 |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | Bacterial membrane pore formation |
Other activities | NA |
PMID | Peptide(64 ul) + INH(4 ul) |
Year of Publication | NA |
Tertiary Structure (Technique) | Not Predicted), |