| Primary information |
|---|
| ID | antitb_1538, |
| Name | 25613372 |
| N-Terminal modification | HCL2 |
| C-Terminal Modification | ESTYQGHHTPPVQKGLRYGIILFITSEVFFFAGFF |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 35 |
| Source | L |
| Origin | Cationic |
| Species | Protein derived |
| Strain | Derived from Cytochrome C oxidase subunit 3 |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Inhibition Concentration | in vitro |
| Sequence | 2015 |
| Cytotoxicity | Human macrophage THP1 |
| In vivo Model | NA |
| Lethal Dose | No cytotoxicity |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Disrupt interaction between ESAT-6 and CFP10 |
| Other activities | bacterial ESAT-6 |
| PMID | NA |
| Year of Publication | NA |
Tertiary Structure
(Technique) | Not Predicted), |