| Primary information |
|---|
| ID | antitb_1538 |
| Peptide Name | HCL2 |
| Sequence | ESTYQGHHTPPVQKGLRYGIILFITSEVFFFAGFF |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 35 |
| Chirality | L |
| Nature | Cationic |
| Source | Protein derived |
| Origin | Derived from Cytochrome C oxidase subunit 3 |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis H37Rv |
| Inhibition Concentartion | NA |
| In vitro/In vivo | in vitro |
| Cell Line | Human macrophage THP1 |
| Inhibition Concentartion | NA |
| Cytotoxicity | No cytotoxicity |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | Disrupt interaction between ESAT-6 and CFP10 |
| Target | bacterial ESAT-6 |
| Combination Therapy | NA |
| Other Activities | NA |
| Pubmed ID | 25613372 |
| Year of Publication | 2015 |
| 3-D Structure |  View in Jmol or Download Structure |