| Primary information |
|---|
| ID | antitb_1537 |
| Peptide Name | Human neutrohil peptide (HNP-1) |
| Sequence | DCYCRIPACIAGERRYGTCIYQGRLWAFCC |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 |
| Linear/ Cyclic | Cyclic |
| Length | 30 |
| Chirality | L |
| Nature | Cationic |
| Source | Natural |
| Origin | Human neutrophil |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis H37Rv |
| Inhibition Concentartion | IC50= 0.0255 μg/ml |
| In vitro/In vivo | in vitro |
| Cell Line | NA |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | Mediate macrophage to induce TNF-α expression |
| Mechanism of Action | Inhibit lipid biosynthesi |
| Target | NA |
| Combination Therapy | HNP-1 + Isoniazid |
| Other Activities | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas |
| Pubmed ID | 25613372 |
| Year of Publication | 2015 |
| 3-D Structure | NA |