| Primary information |
|---|
| ID | antitb_1541, |
| Name | 25613372 |
| N-Terminal modification | RNase3 |
| C-Terminal Modification | RPPQFTRAQWFAIQHISLMPPRCTIAMRAINNYRWRCKNQNTFLR |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 45 |
| Source | L |
| Origin | Cationic |
| Species | Protein derived |
| Strain | Derived from eisinophilic cationic protein (ECP) |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | MIC = 20 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2015 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Disrupt the mycobacterial membrane |
| Other activities | NA |
| PMID | NA |
| Year of Publication | Bactericidal against pseudomonas and staphylococcus at pH 5.5 |
Tertiary Structure
(Technique) | Not Predicted), |
| Primary information |
|---|
| ID | antitb_1542, |
| Name | 25613372 |
| N-Terminal modification | RNAse7 |
| C-Terminal Modification | RPPQFTRAQWFAIQHISLMPPRCTIAMRAINNYRWRCKNQNTFLR |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 45 |
| Source | L |
| Origin | Cationic |
| Species | Protein derived |
| Strain | Derived from eisinophilic cationic protein (ECP) |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | MIC = 10 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2015 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Disrupt the mycobacterial membrane |
| Other activities | NA |
| PMID | NA |
| Year of Publication | Bactericidal against pseudomonas and staphylococcus at pH 5.5 |
Tertiary Structure
(Technique) | Not Predicted), |
| Primary information |
|---|
| ID | antitb_1543, |
| Name | 25613372 |
| N-Terminal modification | RNAse7 |
| C-Terminal Modification | RPPQFTRAQWFAIQHISLMPPRCTIAMRAINNYRWRCKNQNTFLR |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 45 |
| Source | L |
| Origin | Cationic |
| Species | Protein derived |
| Strain | Derived from eisinophilic cationic protein (ECP) |
| Inhibition Concentration | Mycobacterium vaccae |
| In Vitro/ In vivo | Mycobacterium vaccae |
| Cell Line | MIC = 10 μg/ml |
| Inhibition Concentration | in vitro |
| Sequence | 2015 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Disrupt the mycobacterial membrane |
| Other activities | NA |
| PMID | NA |
| Year of Publication | Bactericidal against pseudomonas and staphylococcus at pH 5.5 |
Tertiary Structure
(Technique) | Not Predicted), |