| Primary information |
|---|
| ID | antitb_1354, |
| Name | 10585872 |
| N-Terminal modification | Nk-lysin |
| C-Terminal Modification | NEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKD |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Internal disuphide bond 13 -23 |
| Chirality | Cyclic |
| Nature | 37 |
| Source | L |
| Species | Natural |
| Strain | Pig cytolytic lymphocytes |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv ATCC 25618 |
| Cell Line | IC90 = 30 μM |
| Inhibition Concentration | In vitro |
| Sequence | 1999 |
| Cytotoxicity | Human erythroleukaemia cell line K562 |
| In vivo Model | NA |
| Lethal Dose | 30 % cytolytic activity in range of 3 -7 μM peptide concentration |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | NA |
| PMID | NA |
| Year of Publication | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus |
Tertiary Structure
(Technique) | Not Predicted), |
| Primary information |
|---|
| ID | antitb_1524, |
| Name | 25681127 |
| N-Terminal modification | NK-Lysin |
| C-Terminal Modification | NEDTVTQAASRVCDKMKILRGVCKKIMRTFLRRISKD |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 36 |
| Source | L |
| Origin | Cationic |
| Species | Synthetic |
| Inhibition Concentration | Mycobacterium tuberculosis |
| In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv |
| Cell Line | Reduction in bacterial growth inhibiton to 60% at conc. Of 9.37 mg/L |
| Inhibition Concentration | in vitro |
| Sequence | 2015 |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Inteacting with microbial membrane |
| Other activities | NA |
| PMID | NA |
| Year of Publication | Antibacterial against E.coli, S.aureus, bacillus, pseudomonas |
Tertiary Structure
(Technique) | Not Predicted), |