Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0501 | FasL Click for more detail | Endogenous (others) | MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQPLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSLKVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL | 279 | Pattern-associated molecular patterns (PAMPs) | Natural | NA | FasR | Pattern recognition receptor (PRR) | Stevens-Johnson syndrome/toxic epidermal necrolysis patients | NA | NA | NA | NA | NA | It induce apoptosis | NA | 20703156 | 2010 | NA |
| PRRID_0501 | FasL Click for more detail | Endogenous (others) | MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQPLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSLKVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL | 279 | Pattern-associated molecular patterns (PAMPs) | Natural | NA | FasR | Pattern recognition receptor (PRR) | Stevens-Johnson syndrome/toxic epidermal necrolysis patients | NA | NA | NA | NA | NA | It induce apoptosis | NA | 20703156 | 2010 | NA |
| PRRID_0539 | Glycosylphosphatidyl inositol anchor Click for more detail | Protozoa (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | It coauses the inflammation | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0539 | Glycosylphosphatidyl inositol anchor Click for more detail | Protozoa (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | It coauses the inflammation | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0540 | Glycosylphosphatidyl inositol anchor Click for more detail | Trypanosoma Cruzi (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-α and induces augment PMN migration. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0540 | Glycosylphosphatidyl inositol anchor Click for more detail | Trypanosoma Cruzi (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-α and induces augment PMN migration. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0543 | GPI anchor Click for more detail | T. gondii (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | GPIs binds to the TLR2 and activaes the downstream processes | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | macrophages | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Recognition and phagocytosis | NA | 20729207 | 2010 | Pubchem Assay |
| PRRID_0543 | GPI anchor Click for more detail | T. gondii (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | GPIs binds to the TLR2 and activaes the downstream processes | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | macrophages | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Recognition and phagocytosis | NA | 20729207 | 2010 | Pubchem Assay |
| PRRID_0573 | IL-4 Click for more detail | Endogenous (others) | MGLTSQLLPPLFFLLACAGNFVHGHKCDITLQEIIKTLNSLTEQKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS | 137 | Pattern-associated molecular patterns (PAMPs) | Natural | NA | IL4R | Pattern recognition receptor (PRR) | Stevens-Johnson syndrome/toxic epidermal necrolysis patients | NA | NA | P24394.fasta | P24394 | 825 | NA | NA | 20703156 | 2010 | Pubchem Assay |
| PRRID_0573 | IL-4 Click for more detail | Endogenous (others) | MGLTSQLLPPLFFLLACAGNFVHGHKCDITLQEIIKTLNSLTEQKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS | 137 | Pattern-associated molecular patterns (PAMPs) | Natural | NA | IL4R | Pattern recognition receptor (PRR) | Stevens-Johnson syndrome/toxic epidermal necrolysis patients | NA | NA | P24394.fasta | P24394 | 825 | NA | NA | 20703156 | 2010 | Pubchem Assay |
| PRRID_0601 | LAM Click for more detail | Mycobacteria (Bacteria) | OC[C@H]1O[C@@H](S[C@H]2[C@H](O)[C@@H](CO)O[C@@H](O[C@@H]3[C@H](O)[C@@H](CO)O[C@H](Oc4ccc(cc4)[N+]([O-])=O)[C@@H]3O)[C@@H]2O)[C@H](O)[C@@H](O)[C@@H]1O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-α and induces augment PMN migration. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0601 | LAM Click for more detail | Mycobacteria (Bacteria) | OC[C@H]1O[C@@H](S[C@H]2[C@H](O)[C@@H](CO)O[C@@H](O[C@@H]3[C@H](O)[C@@H](CO)O[C@H](Oc4ccc(cc4)[N+]([O-])=O)[C@@H]3O)[C@@H]2O)[C@H](O)[C@@H](O)[C@@H]1O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-α and induces augment PMN migration. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0685 | MPLA Click for more detail | Salmonella minnesota R595 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)NC1C(C(C(OC1O)COC2C(C(C(C(O2)CO)OP(=O)(O)O)OC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Rabbit | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | G1SH24.fasta | G1SH24 | 839 | 1,000-fold less toxic than LPS and can be used as vaccines | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0685 | MPLA Click for more detail | Salmonella minnesota R595 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)NC1C(C(C(OC1O)COC2C(C(C(C(O2)CO)OP(=O)(O)O)OC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Rabbit | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | G1SH24.fasta | G1SH24 | 839 | 1,000-fold less toxic than LPS and can be used as vaccines | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0686 | MPLA Click for more detail | Salmonella minnesota R595 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)NC1C(C(C(OC1O)COC2C(C(C(C(O2)CO)OP(=O)(O)O)OC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Guinea Pig | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | H0VSQ0.fasta | H0VSQ0 | 837 | 1,000-fold less toxic than LPS and can be used as vaccines | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0686 | MPLA Click for more detail | Salmonella minnesota R595 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)NC1C(C(C(OC1O)COC2C(C(C(C(O2)CO)OP(=O)(O)O)OC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Guinea Pig | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | H0VSQ0.fasta | H0VSQ0 | 837 | 1,000-fold less toxic than LPS and can be used as vaccines | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0687 | MPLA Click for more detail | Salmonella minnesota R595 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)NC1C(C(C(OC1O)COC2C(C(C(C(O2)CO)OP(=O)(O)O)OC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Dogs | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | F1PDB9.fasta | F1PDB9 | 833 | 1,000-fold less toxic than LPS and can be used as vaccines | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0687 | MPLA Click for more detail | Salmonella minnesota R595 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)NC1C(C(C(OC1O)COC2C(C(C(C(O2)CO)OP(=O)(O)O)OC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Dogs | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | F1PDB9.fasta | F1PDB9 | 833 | 1,000-fold less toxic than LPS and can be used as vaccines | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0688 | MPLA Click for more detail | Salmonella minnesota R595 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)NC1C(C(C(OC1O)COC2C(C(C(C(O2)CO)OP(=O)(O)O)OC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Horse | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | F6RL35.fasta | F6RL35 | 843 | 1,000-fold less toxic than LPS and can be used as vaccines | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0688 | MPLA Click for more detail | Salmonella minnesota R595 (Bacteria) | CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)NC1C(C(C(OC1O)COC2C(C(C(C(O2)CO)OP(=O)(O)O)OC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Horse | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | F6RL35.fasta | F6RL35 | 843 | 1,000-fold less toxic than LPS and can be used as vaccines | NA | 20713100 | 2010 | Pubchem Assay |
| PRRID_0701 | NA Click for more detail | Acanthocheilonema viteae(others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Scavenger receptor class A | Scavenger receptor (SR) | Mice | lamina propria macrophage | NA | Q08857.fasta | Q08857 | 472 | It protect against microbial induced pregnancy loss | NA | 20711846 | 2010 | Pubchem Assay |
| PRRID_0701 | NA Click for more detail | Acanthocheilonema viteae(others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Scavenger receptor class A | Scavenger receptor (SR) | Mice | lamina propria macrophage | NA | Q08857.fasta | Q08857 | 472 | It protect against microbial induced pregnancy loss | NA | 20711846 | 2010 | Pubchem Assay |
| PRRID_0702 | NA Click for more detail | Acanthocheilonema viteae(others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Scavenger receptor class A | Scavenger receptor (SR) | Mice | lamina propria macrophage | NA | Q08857.fasta | Q08857 | 472 | It protect against microbial induced pregnancy loss | NA | 20711846 | 2010 | Pubchem Assay |
| PRRID_0702 | NA Click for more detail | Acanthocheilonema viteae(others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Scavenger receptor class A | Scavenger receptor (SR) | Mice | lamina propria macrophage | NA | Q08857.fasta | Q08857 | 472 | It protect against microbial induced pregnancy loss | NA | 20711846 | 2010 | Pubchem Assay |
| PRRID_0812 | Surface structure Click for more detail | Virus | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | NA | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0812 | Surface structure Click for more detail | Virus | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | NA | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0813 | Surface structure Click for more detail | Virus | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | NA | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0813 | Surface structure Click for more detail | Virus | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | NA | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | NA | NA | 20739519 | 2010 | Pubchem Assay |
| PRRID_0824 | Unknown Click for more detail | P. syringae (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | It has role in disease resistance. | CERK1 | Pattern recognition receptor (PRR) | Plants | NA | NA | A8R7E6.fasta | A8R7E6 | 617 | It has role in disease resistance. | NA | 20713980 | 2010 | Pubchem Assay |
| PRRID_0824 | Unknown Click for more detail | P. syringae (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | It has role in disease resistance. | CERK1 | Pattern recognition receptor (PRR) | Plants | NA | NA | A8R7E6.fasta | A8R7E6 | 617 | It has role in disease resistance. | NA | 20713980 | 2010 | Pubchem Assay |
| PRRID_0841 | Virus Click for more detail | T. gondii (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | It induces Crp-3/-5 production and release by PCs via a TLR9-dependent production of type I IFNs | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | C57BL/6 Mice | epithial cells | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It affect the early control of T. gondii invasiveness by promoting the initiation of a protective Th1 response against the parasite | NA | 20488791 | 2010 | Pubchem Assay |
| PRRID_0841 | Virus Click for more detail | T. gondii (others) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | It induces Crp-3/-5 production and release by PCs via a TLR9-dependent production of type I IFNs | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | C57BL/6 Mice | epithial cells | Leucine-rich Repeat (LRR) Domain | Q9NR96.fasta | Q9NR96 | 1032 | It affect the early control of T. gondii invasiveness by promoting the initiation of a protective Th1 response against the parasite | NA | 20488791 | 2010 | Pubchem Assay |
| PRRID_0863 | LTA Click for more detail | Gram-positive bacteria | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0863 | LTA Click for more detail | Gram-positive bacteria | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung's endothelial cell | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It has the role in the inflammation. | NA | 20706658 | 2010 | Pubchem Assay |
| PRRID_0864 | β- 1,3-glucan Click for more detail | Gram-negative bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | DmGNBP1 | Gram-negative Bacteria-binding Protein (GNBPs) | Drosophila melanogaster | NA | NA | Q9NHB0.fasta | Q9NHB0 | 494 | It induces the proteolytic cascade | NA | 20699104 | 2010 | Pubchem Assay |
| PRRID_0864 | β- 1,3-glucan Click for more detail | Gram-negative bacteria | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | NA | DmGNBP1 | Gram-negative Bacteria-binding Protein (GNBPs) | Drosophila melanogaster | NA | NA | Q9NHB0.fasta | Q9NHB0 | 494 | It induces the proteolytic cascade | NA | 20699104 | 2010 | Pubchem Assay |
| PRRID_0872 | Bropirimine Click for more detail | NA | C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | experimental drug with anti-cancer and antiviral properties | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | B cells, dendritic cells, microglia, astrocytes | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NA | 21982558 | 2011 | Pubchem Assay |
| PRRID_0872 | Bropirimine Click for more detail | NA | C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | experimental drug with anti-cancer and antiviral properties | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | B cells, dendritic cells, microglia, astrocytes | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NA | 21982558 | 2011 | Pubchem Assay |
| PRRID_0873 | Bropirimine Click for more detail | NA | C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | experimental drug with anti-cancer and antiviral properties | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | TLR7-mediated activation of these cells resulted in the induction of the pro-inflammatory cytokines IFN-α, IFN-β, TNF-α, and IL-13 | NA | 21955443 | 2011 | NA |
| PRRID_0873 | Bropirimine Click for more detail | NA | C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | experimental drug with anti-cancer and antiviral properties | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | TLR7-mediated activation of these cells resulted in the induction of the pro-inflammatory cytokines IFN-α, IFN-β, TNF-α, and IL-13 | NA | 21955443 | 2011 | NA |
| PRRID_0911 | iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail | Bacteria | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | peptidoglycan substructures | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Eosinophils | NA | Q9Y239.fasta | Q9Y239 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0911 | iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail | Bacteria | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | peptidoglycan substructures | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Eosinophils | NA | Q9Y239.fasta | Q9Y239 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0912 | Imidazoquinoline Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CC1=C(NC(=C(C1=C2C=CC(=C(C2=O)OC)OC)N)C3=NC4=C(C=C3)C(=O)C(=C5C4=NC(N5)(C)C)OC)C(=O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | B cells, dendritic cells, microglia, astrocytes | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | TLR7-mediated activation of these cells resulted in the induction of the pro-inflammatory cytokines IFN-α, IFN-β, TNF-α, and IL-12 | NA | 21982558 | 2011 | Pubchem Assay |
| PRRID_0912 | Imidazoquinoline Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CC1=C(NC(=C(C1=C2C=CC(=C(C2=O)OC)OC)N)C3=NC4=C(C=C3)C(=O)C(=C5C4=NC(N5)(C)C)OC)C(=O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | B cells, dendritic cells, microglia, astrocytes | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | TLR7-mediated activation of these cells resulted in the induction of the pro-inflammatory cytokines IFN-α, IFN-β, TNF-α, and IL-12 | NA | 21982558 | 2011 | Pubchem Assay |
| PRRID_0913 | Imidazoquinoline Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CC1=C(NC(=C(C1=C2C=CC(=C(C2=O)OC)OC)N)C3=NC4=C(C=C3)C(=O)C(=C5C4=NC(N5)(C)C)OC)C(=O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | TLR7-mediated activation of these cells resulted in the induction of the pro-inflammatory cytokines IFN-α, IFN-β, TNF-α, and IL-13 | NA | 21955443 | 2011 | NA |
| PRRID_0913 | Imidazoquinoline Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CC1=C(NC(=C(C1=C2C=CC(=C(C2=O)OC)OC)N)C3=NC4=C(C=C3)C(=O)C(=C5C4=NC(N5)(C)C)OC)C(=O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | TLR7-mediated activation of these cells resulted in the induction of the pro-inflammatory cytokines IFN-α, IFN-β, TNF-α, and IL-13 | NA | 21955443 | 2011 | NA |
| PRRID_0914 | Imidazoquinoline Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CC1=C(NC(=C(C1=C2C=CC(=C(C2=O)OC)OC)N)C3=NC4=C(C=C3)C(=O)C(=C5C4=NC(N5)(C)C)OC)C(=O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | important role in the immune response to viral infection | NA | 21955443 | 2011 | NA |
| PRRID_0914 | Imidazoquinoline Click for more detail | A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring | CC1=C(NC(=C(C1=C2C=CC(=C(C2=O)OC)OC)N)C3=NC4=C(C=C3)C(=O)C(=C5C4=NC(N5)(C)C)OC)C(=O)O | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | Imidazoquinolines are being actively being pursued for therapeutic use anti-viral and anti- allergic | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | important role in the immune response to viral infection | NA | 21955443 | 2011 | NA |
| PRRID_0939 | Paclitaxel Click for more detail | Pacific yew (plant) | C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | used to treat a number of types of cancer | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | Myeloid cells, microglia, astrocytes, neurons | NA | Q9HC29.fasta | Q9HC29 | 1040 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | NA | 21982558 | 2011 | Pubchem Assay |
| PRRID_0939 | Paclitaxel Click for more detail | Pacific yew (plant) | C1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | used to treat a number of types of cancer | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | Myeloid cells, microglia, astrocytes, neurons | NA | Q9HC29.fasta | Q9HC29 | 1040 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | NA | 21982558 | 2011 | Pubchem Assay |
| PRRID_0954 | Porins Click for more detail | Neisseria meningitidis (Bacteria) | MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVTKAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAGEFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGSVQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKYARHANVGRNAFELFLIGSARSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENGDKAKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRTSAIVSGAWLKRNTGIGNYTQINAASVGLRHKF | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | significant role in the pathogenesis of severe inflammatory responses | NA | 21955443 | 2011 | NA |
| PRRID_0954 | Porins Click for more detail | Neisseria meningitidis (Bacteria) | MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVTKAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAGEFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGSVQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKYARHANVGRNAFELFLIGSARSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENGDKAKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRTSAIVSGAWLKRNTGIGNYTQINAASVGLRHKF | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | significant role in the pathogenesis of severe inflammatory responses | NA | 21955443 | 2011 | NA |
| PRRID_0957 | Resiquimod (R-848) Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune-response modifier possessing antiviral and antitumor activityand also induces the differentiation of MDSCs into mature myeloid cells | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | important role in the immune response to viral infection | NA | 21949866 | 2011 | NA |
| PRRID_0957 | Resiquimod (R-848) Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune-response modifier possessing antiviral and antitumor activityand also induces the differentiation of MDSCs into mature myeloid cells | Toll-like receptor 8 (TLR8) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | important role in the immune response to viral infection | NA | 21949866 | 2011 | NA |
| PRRID_0963 | Soluble factors Click for more detail | Neisseria meningitidis (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | triggers immune responses | Toll-like receptor 1 (TLR1) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | NA | NA | 21955443 | 2011 | NA |
| PRRID_0963 | Soluble factors Click for more detail | Neisseria meningitidis (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | triggers immune responses | Toll-like receptor 1 (TLR1) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | NA | NA | 21955443 | 2011 | NA |
| PRRID_0965 | Taxol Click for more detail | Plant | CC1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | used to treat a number of types of cancer | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | plays a fundamental role in pathogen recognition and activation of innate immunity | NA | 21955443 | 2011 | NA |
| PRRID_0965 | Taxol Click for more detail | Plant | CC1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | used to treat a number of types of cancer | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | plays a fundamental role in pathogen recognition and activation of innate immunity | NA | 21955443 | 2011 | NA |
| PRRID_0971 | Uropathogenic E. coli Click for more detail | Bacteria | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 10 (TLR10) | Toll-like receptor (TLR) | Human | Myeloid cells, uroepithelial cells | NA | NA | NA | NA | TLR11 plays a fundamental role in both the innate and adaptive immune responses, through the activation of Tumor necrosis factor-alpha,the Interleukin 12 (IL-12) response and Interferon-gamma (IFN-gamma) secretion. | NA | 21982558 | 2011 | NA |
| PRRID_0971 | Uropathogenic E. coli Click for more detail | Bacteria | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 10 (TLR10) | Toll-like receptor (TLR) | Human | Myeloid cells, uroepithelial cells | NA | NA | NA | NA | TLR11 plays a fundamental role in both the innate and adaptive immune responses, through the activation of Tumor necrosis factor-alpha,the Interleukin 12 (IL-12) response and Interferon-gamma (IFN-gamma) secretion. | NA | 21982558 | 2011 | NA |
| PRRID_1026 | Bropirimine Click for more detail | NA | C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | experimental drug with anti-cancer and antiviral properties | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1026 | Bropirimine Click for more detail | NA | C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | experimental drug with anti-cancer and antiviral properties | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1028 | Bropirimine Click for more detail | NA | C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | experimental drug with anti-cancer and antiviral properties | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1028 | Bropirimine Click for more detail | NA | C1=CC=C(C=C1)C2=C(C(=O)N=C(N2)N)Br | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | experimental drug with anti-cancer and antiviral properties | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem Assay |
| PRRID_1036 | EfLTA Click for more detail | Endogenous (others) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | play an important role in inducing non-specific resistance against a broad range of viral infections. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | NA | NA | NA | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | NA |
| PRRID_1036 | EfLTA Click for more detail | Endogenous (others) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | play an important role in inducing non-specific resistance against a broad range of viral infections. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | NA | NA | NA | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | NA |
| PRRID_1037 | EfLTA Click for more detail | Enterococcus faecalis (Bacteria) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | LTA contributes to the inflammatory responses and to the production of chemokines through TLR2 signaling | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | C57BL/6 mice | Macrophages | NA | Q9QUN7.fasta | Q9QUN7 | 784 | triggers the MyD88-dependent signaling pathway, leading to NF-kB activation | ELISA, RT-PCR, Flow cytometric analysis | 23964117 | 2013 | Pubchem_assay |
| PRRID_1037 | EfLTA Click for more detail | Enterococcus faecalis (Bacteria) | C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O | NA | Pattern-associated molecular patterns (PAMPs) | Natural | LTA contributes to the inflammatory responses and to the production of chemokines through TLR2 signaling | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | C57BL/6 mice | Macrophages | NA | Q9QUN7.fasta | Q9QUN7 | 784 | triggers the MyD88-dependent signaling pathway, leading to NF-kB activation | ELISA, RT-PCR, Flow cytometric analysis | 23964117 | 2013 | Pubchem_assay |
| PRRID_1065 | HKLM Click for more detail | heat-killed Listeria monocytogenes (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | triggers immune responses | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | HEK293 cells | NA | O60603.fasta | O60603 | 784 | significant role in the pathogenesis of severe inflammatory responses | NF- | 24098508 | 2013 | Pubchem_assay |
| PRRID_1065 | HKLM Click for more detail | heat-killed Listeria monocytogenes (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | triggers immune responses | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | HEK293 cells | NA | O60603.fasta | O60603 | 784 | significant role in the pathogenesis of severe inflammatory responses | NF- | 24098508 | 2013 | Pubchem_assay |
| PRRID_1066 | HKVP Click for more detail | heat-killed Vibrio Parahaemolyticus (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | triggers immune responses | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | HEK293 cells | NA | O60603.fasta | O60603 | 784 | NA | NF- | 24098508 | 2013 | Pubchem_assay |
| PRRID_1066 | HKVP Click for more detail | heat-killed Vibrio Parahaemolyticus (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | triggers immune responses | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | HEK293 cells | NA | O60603.fasta | O60603 | 784 | NA | NF- | 24098508 | 2013 | Pubchem_assay |
| PRRID_1085 | Imiquimod Click for more detail | imidazoquinoline amine analogue to guanosine (others) | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | HEK293 cells | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NF- | 24098508 | 2013 | Pubchem_assay |
| PRRID_1085 | Imiquimod Click for more detail | imidazoquinoline amine analogue to guanosine (others) | CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Natural | Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity. | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | HEK293 cells | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NF- | 24098508 | 2013 | Pubchem_assay |
| PRRID_1105 | Macrophage activating lipoprotein-2 (MALP-2) Click for more detail | Mycoplasma fermentans (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | It primes macrophages for cytokines secretion | Toll-like receptor 6 /2 (TLR6/2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells | Cell Surface (Exogenous) | NA | NA | NA | fundamental role in pathogen recognition and activation of innate immunity. | NA | 23985302 | 2013 | NA |
| PRRID_1105 | Macrophage activating lipoprotein-2 (MALP-2) Click for more detail | Mycoplasma fermentans (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | It primes macrophages for cytokines secretion | Toll-like receptor 6 /2 (TLR6/2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells | Cell Surface (Exogenous) | NA | NA | NA | fundamental role in pathogen recognition and activation of innate immunity. | NA | 23985302 | 2013 | NA |
| PRRID_1107 | Macrophage activating lipoprotein-2 (MALP-2) Click for more detail | Mycoplasma fermentans (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | It primes macrophages for cytokines secretion | Toll-like receptor 6 /2 (TLR6/2) | Toll-like receptor (TLR) | Human | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells | Cell Surface (Exogenous) | NA | NA | NA | fundamental role in pathogen recognition and activation of innate immunity. | NA | 23985302 | 2013 | NA |
| PRRID_1107 | Macrophage activating lipoprotein-2 (MALP-2) Click for more detail | Mycoplasma fermentans (Bacteria) | NA | NA | Pattern-associated molecular patterns (PAMPs) | Natural | It primes macrophages for cytokines secretion | Toll-like receptor 6 /2 (TLR6/2) | Toll-like receptor (TLR) | Human | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells | Cell Surface (Exogenous) | NA | NA | NA | fundamental role in pathogen recognition and activation of innate immunity. | NA | 23985302 | 2013 | NA |
| PRRID_1112 | ODN2006 Click for more detail | oligonucleotides containing unmethylated CpG dinucleotides (others) | 5’-tcgtcgttttgtcgttttgtcgtt-3’ | 24 | Pattern-associated molecular patterns (PAMPs) | Synthetic | induce strong immunostimulatory effects trough activation of TLR9 in mammalian cells and type B CpG ODN2006 significantly induced IL-1b and IFN-a1 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | HEK293 cells | NA | Q9NR96.fasta | Q9NR96 | 1032 | TLR9 plays a crucial role in breaking tolerance and developing autoimmunity | NF- | 24098508 | 2013 | Pubchem_assay |
| PRRID_1112 | ODN2006 Click for more detail | oligonucleotides containing unmethylated CpG dinucleotides (others) | 5’-tcgtcgttttgtcgttttgtcgtt-3’ | 24 | Pattern-associated molecular patterns (PAMPs) | Synthetic | induce strong immunostimulatory effects trough activation of TLR9 in mammalian cells and type B CpG ODN2006 significantly induced IL-1b and IFN-a1 | Toll-like receptor 9 (TLR9) | Toll-like receptor (TLR) | Human | HEK293 cells | NA | Q9NR96.fasta | Q9NR96 | 1032 | TLR9 plays a crucial role in breaking tolerance and developing autoimmunity | NF- | 24098508 | 2013 | Pubchem_assay |
| PRRID_1126 | Porins Click for more detail | Neisseria meningitidis (Bacteria) | MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVTKAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAGEFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGSVQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKYARHANVGRNAFELFLIGSARSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENGDKAKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRTSAIVSGAWLKRNTGIGNYTQINAASVGLRHKF | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 6 /2 (TLR6/2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | NA | NA | NA | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | NA |
| PRRID_1126 | Porins Click for more detail | Neisseria meningitidis (Bacteria) | MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVTKAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAGEFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGSVQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKYARHANVGRNAFELFLIGSARSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENGDKAKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRTSAIVSGAWLKRNTGIGNYTQINAASVGLRHKF | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 6 /2 (TLR6/2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | NA | NA | NA | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | NA |
| PRRID_1128 | Porins Click for more detail | Neisseria meningitidis (Bacteria) | MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVTKAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAGEFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGSVQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKYARHANVGRNAFELFLIGSARSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENGDKAKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRTSAIVSGAWLKRNTGIGNYTQINAASVGLRHKF | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells | Cell Surface (Exogenous) | Q9QUN7.fasta | Q9QUN7 | 784 | fundamental role in pathogen recognition and activation of innate immunity. | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1128 | Porins Click for more detail | Neisseria meningitidis (Bacteria) | MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVTKAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAGEFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGSVQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKYARHANVGRNAFELFLIGSARSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENGDKAKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRTSAIVSGAWLKRNTGIGNYTQINAASVGLRHKF | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells | Cell Surface (Exogenous) | Q9QUN7.fasta | Q9QUN7 | 784 | fundamental role in pathogen recognition and activation of innate immunity. | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1131 | R-848 Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | sufficient to permit access of activated T-cells to peripheral tissues and induce GVHD | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | graft-versus-host disease (GVHD) | NA | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1131 | R-848 Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | sufficient to permit access of activated T-cells to peripheral tissues and induce GVHD | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | graft-versus-host disease (GVHD) | NA | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1132 | Porins Click for more detail | Neisseria meningitidis (Bacteria) | MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVTKAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAGEFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGSVQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKYARHANVGRNAFELFLIGSARSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENGDKAKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRTSAIVSGAWLKRNTGIGNYTQINAASVGLRHKF | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells | Cell Surface (Exogenous) | O60603.fasta | O60603 | 784 | fundamental role in pathogen recognition and activation of innate immunity. | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1132 | Porins Click for more detail | Neisseria meningitidis (Bacteria) | MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVTKAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAGEFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGSVQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKYARHANVGRNAFELFLIGSARSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENGDKAKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRTSAIVSGAWLKRNTGIGNYTQINAASVGLRHKF | 396 | Pattern-associated molecular patterns (PAMPs) | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells | Cell Surface (Exogenous) | O60603.fasta | O60603 | 784 | fundamental role in pathogen recognition and activation of innate immunity. | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1133 | Resiquimod (R-848) Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune-response modifier possessing antiviral and antitumor activityand also induces the differentiation of MDSCs into mature myeloid cells | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1133 | Resiquimod (R-848) Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune-response modifier possessing antiviral and antitumor activityand also induces the differentiation of MDSCs into mature myeloid cells | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1134 | Resiquimod (R-848) Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune-response modifier possessing antiviral and antitumor activityand also induces the differentiation of MDSCs into mature myeloid cells | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1134 | Resiquimod (R-848) Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune-response modifier possessing antiviral and antitumor activityand also induces the differentiation of MDSCs into mature myeloid cells | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes | Cell Compartment/Intracellular (Endosome) | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1135 | Resiquimod (R-848) Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune-response modifier possessing antiviral and antitumor activityand also induces the differentiation of MDSCs into mature myeloid cells | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, mast cells | Cell Compartment/Intracellular (Endosome) | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1135 | Resiquimod (R-848) Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune-response modifier possessing antiviral and antitumor activityand also induces the differentiation of MDSCs into mature myeloid cells | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, mast cells | Cell Compartment/Intracellular (Endosome) | P58681.fasta | P58681 | 1050 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1140 | Resiquimod (R-848) Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune-response modifier possessing antiviral and antitumor activityand also induces the differentiation of MDSCs into mature myeloid cells | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | monocyte/macrophages, DCs, mast cells | Cell Compartment/Intracellular (Endosome) | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1140 | Resiquimod (R-848) Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | immune-response modifier possessing antiviral and antitumor activityand also induces the differentiation of MDSCs into mature myeloid cells | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | monocyte/macrophages, DCs, mast cells | Cell Compartment/Intracellular (Endosome) | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1148 | R-848 Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | sufficient to permit access of activated T-cells to peripheral tissues and induce GVHD | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | graft-versus-host disease (GVHD) | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1148 | R-848 Click for more detail | imidazoquinoline (others) | CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N | NA | Pattern-associated molecular patterns (PAMPs) | Synthetic | sufficient to permit access of activated T-cells to peripheral tissues and induce GVHD | Toll-like receptor 7 (TLR7) | Toll-like receptor (TLR) | Human | graft-versus-host disease (GVHD) | NA | Q9NYK1.fasta | Q9NYK1 | 1049 | important role in the immune response to viral infection | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1154 | Snapin A Click for more detail | Endogenous (others) | MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK | 136 | Pattern-associated molecular patterns (PAMPs) | Natural | triggers immune responses | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | Q9QUN7.fasta | Q9QUN7 | 784 | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1154 | Snapin A Click for more detail | Endogenous (others) | MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK | 136 | Pattern-associated molecular patterns (PAMPs) | Natural | triggers immune responses | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | Q9QUN7.fasta | Q9QUN7 | 784 | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | Pubchem_assay |