| Primary information |
|---|
| PRRID | PRRID_1154 |
| Ligand Name | Snapin A |
| Source | Endogenous (others) |
| Sequence of ligand | MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK |
| Length | 136 |
| Type | Pattern-associated molecular patterns (PAMPs) |
| Occurence | Natural |
| Role of Ligand | triggers immune responses |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, DCs, B-lymphocytes |
| Domain | extracellular domains of leucine-rich repeat motifs |
| Sequence of Receptor | Q9QUN7.fasta |
| Swiss prot ID | Q9QUN7 |
| Length Of Receptor | 784 |
| Function | significant role in the pathogenesis of severe inflammatory responses |
| Assay used | NA |
| PMID | 23985302 |
| Year of Publication | 2013 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1154 |
| Ligand Name | Snapin A |
| Source | Endogenous (others) |
| Sequence of ligand | MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK |
| Length | 136 |
| Type | Pattern-associated molecular patterns (PAMPs) |
| Occurence | Natural |
| Role of Ligand | triggers immune responses |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, DCs, B-lymphocytes |
| Domain | extracellular domains of leucine-rich repeat motifs |
| Sequence of Receptor | Q9QUN7.fasta |
| Swiss prot ID | Q9QUN7 |
| Length Of Receptor | 784 |
| Function | significant role in the pathogenesis of severe inflammatory responses |
| Assay used | NA |
| PMID | 23985302 |
| Year of Publication | 2013 |
| Pubchem assay | Pubchem_assay |