Detailed description page of PRRDB2.0
| This page displays user query in tabular form. |
PRRID_0501 details |
| Primary information | |
|---|---|
| PRRID | PRRID_0501 |
| Ligand Name | FasL |
| Source | Endogenous (others) |
| Sequence of ligand | MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQPLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSLKVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL |
| Length | 279 |
| Type | Pattern-associated molecular patterns (PAMPs) |
| Occurence | Natural |
| Role of Ligand | NA |
| Name of receptor | FasR |
| Type of receptor | Pattern recognition receptor (PRR) |
| Source | Stevens-Johnson syndrome/toxic epidermal necrolysis patients |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | It induce apoptosis |
| Assay used | NA |
| PMID | 20703156 |
| Year of Publication | 2010 |
| Pubchem assay | NA |
| Primary information | |
|---|---|
| PRRID | PRRID_0501 |
| Ligand Name | FasL |
| Source | Endogenous (others) |
| Sequence of ligand | MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQPLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSLKVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL |
| Length | 279 |
| Type | Pattern-associated molecular patterns (PAMPs) |
| Occurence | Natural |
| Role of Ligand | NA |
| Name of receptor | FasR |
| Type of receptor | Pattern recognition receptor (PRR) |
| Source | Stevens-Johnson syndrome/toxic epidermal necrolysis patients |
| Localization | NA |
| Domain | NA |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | It induce apoptosis |
| Assay used | NA |
| PMID | 20703156 |
| Year of Publication | 2010 |
| Pubchem assay | NA |