Fermented Food Database
This is the result page of browse. This page gives the information about peptides returned against the selected category. Further details of the peptide can be seen by clicking on the FMDB_ID. Further the user can sort the peptides on the basis of various fields by clicking on the respective headers.
The total number entries retrieved from this search are 590| FMDB_ID | PubMed ID | Reference | Title | Peptide_Sequence | Sequence | Length of peptide | Food_Matrix | Protein | pH | Temperature | Incubation Time | Activity | Experiment | Model | Assay for Activity Measurement | Culture | Hydrolysis | Method of analysis | M_Z ratio | Mass | IC50 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| FMDB64 | 10966406 | NA | NA | LNVPGEIVE | LNVPGEIVE | 9 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 969.5 | 300.1umol/l |
| FMDB65 | 10966406 | NA | NA | NIPPLTQTPV | NIPPLTQTPV | 10 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 1079.6 | 173.3 umol/l |
| FMDB66 | 10966406 | NA | NA | IPPLTQTPV | IPPLTQTPV | 9 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 965.5 | NA |
| FMDB67 | 10966406 | NA | NA | PPLTQTPV | PPLTQTPV | 8 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 852.4 | NA |
| FMDB68 | 10966406 | NA | NA | NVPGEIVE | NVPGEIVE | 8 | UHT skim Milk | β-Casein | NA | 37C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactobacillus delbrueckii subsp. bulgaricus SS1 | proteinase and peptidase | FABMS | NA | 856.4 | NA |
| FMDB69 | 10966406 | NA | NA | NVPGEIVE | NVPGEIVE | 8 | UHT skim Milk | β-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 856.4 | NA |
| FMDB70 | 10966406 | NA | NA | DKIHPF | DKIHPF | 6 | UHT skim Milk | β-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 755.4 | 256.8umol/l |
| FMDB71 | 10966406 | NA | NA | KVLPVPE | KVLPVPE | 7 | UHT skim Milk | β-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 780.1 | NA |
| FMDB72 | 10966406 | NA | NA | VIGSPPEIN | VIGSPPEIN | 9 | UHT skim Milk | k-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 996.5 | >1000umol/l |
| FMDB73 | 10966406 | NA | NA | SPPEIN | SPPEIN | 6 | UHT skim Milk | k-Casein | NA | 30C | 72h | Ace-inhibitory | In vitro | NA | NA | Lactococcus lactis subsp. cremoris FT4 | proteinase and peptidase | FABMS | NA | 655.7 | NA |
| FMDB74 | 26877633 | NA | NA | RELEELNVPGEIVE | RELEELNVPGEIVE | 14 | Skimmed Milk | β-Casein | NA | 37C | 24h | NA | NA | NA | Spectrophotometric assay | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 812.9118+2 | NA | NA |
| FMDB75 | 26877633 | NA | NA | MPFPKYPVEPFTESQSL | MPFPKYPVEPFTESQSL | 17 | Skimmed Milk | β-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 998.9681+2 | NA | NA |
| FMDB76 | 26877633 | NA | NA | YQEPVLGPVRGPFP | YQEPVLGPVRGPFP | 14 | Skimmed Milk | β-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 778.3948+2 | NA | NA |
| FMDB77 | 26877633 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Skimmed Milk | β-Casein | NA | 37C | 24h | Ace-inhibitory | In vitro | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 941.0134+2 | NA | NA |
| FMDB78 | 26877633 | NA | NA | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | Skimmed Milk | β-Casein | NA | 37C | 24h | Ace-inhibitory | In vitro | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 850.9726+2 | NA | NA |
| FMDB79 | 26877633 | NA | NA | EPVLGPVRGPFP | EPVLGPVRGPFP | 12 | Skimmed Milk | β-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 632.8387+2 | NA | NA |
| FMDB80 | 26877633 | NA | NA | EPVLGPVRGPFPIIV | EPVLGPVRGPFPIIV | 15 | Skimmed Milk | β-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 795.4579+2 | NA | NA |
| FMDB81 | 26877633 | NA | NA | PVLGPVRGPFPIIV | PVLGPVRGPFPIIV | 14 | Skimmed Milk | β-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 730.9369+2 | NA | NA |
| FMDB82 | 26877633 | NA | NA | VLGPVRGPFPIIV | VLGPVRGPFPIIV | 13 | Skimmed Milk | β-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 682.4100+2 | NA | NA |
| FMDB83 | 26877633 | NA | NA | LGPVRGPFPIIV | LGPVRGPFPIIV | 12 | Skimmed Milk | β-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 632.8768+2 | NA | NA |
| FMDB84 | 26877633 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Skimmed Milk | β-Casein | NA | 37C | 24h | Ace-inhibitory | In vitro | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 576.3378+2 | NA | NA |
| FMDB85 | 26877633 | NA | NA | LPQEVLNENLL | LPQEVLNENLL | 11 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 652.3267+2 | NA | NA |
| FMDB86 | 26877633 | NA | NA | LPQEVLNENLLRF | LPQEVLNENLLRF | 13 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 792.9204+2 | NA | NA |
| FMDB87 | 26877633 | NA | NA | APFPEVFGK | APFPEVFGK | 9 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 496.2541+2 | NA | NA |
| FMDB88 | 26877633 | NA | NA | APSFSDIPNPIGSEN | APSFSDIPNPIGSEN | 15 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 783.8367+2 | NA | NA |
| FMDB89 | 26877633 | NA | NA | APSFSDIPNPIGSENSEKTTMP | APSFSDIPNPIGSENSEKTTMP | 22 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1160.019+2 | NA | NA |
| FMDB90 | 26877633 | NA | NA | APSFSDIPNPIGSENSEKTTMPLW | APSFSDIPNPIGSENSEKTTMPLW | 24 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 878.7391+2 | NA | NA |
| FMDB91 | 26877633 | NA | NA | PSFSDIPNPIGSENSEKTTMP | PSFSDIPNPIGSENSEKTTMP | 21 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1102.488+2 | NA | NA |
| FMDB92 | 26877633 | NA | NA | SFSDIPNPIGSENSEKTTMPLW | SFSDIPNPIGSENSEKTTMPLW | 22 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1225.555+2 | NA | NA |
| FMDB93 | 26877633 | NA | NA | FSDIPNPIGSENSEKTTMPLW | FSDIPNPIGSENSEKTTMPLW | 21 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1182.031+2 | NA | NA |
| FMDB94 | 26877633 | NA | NA | SDIPNPIGSENSEKTTMPLW | SDIPNPIGSENSEKTTMPLW | 20 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1108.502+2 | NA | NA |
| FMDB95 | 26877633 | NA | NA | DIPNPIGSENSEKTTMPLW | DIPNPIGSENSEKTTMPLW | 19 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1064.983+2 | NA | NA |
| FMDB96 | 26877633 | NA | NA | IPNPIGSENSEKTTMPL | IPNPIGSENSEKTTMPL | 17 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 905.4299+2 | NA | NA |
| FMDB97 | 26877633 | NA | NA | IPNPIGSENSEKTTMPLW | IPNPIGSENSEKTTMPLW | 18 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1015.474+2 | NA | NA |
| FMDB98 | 26877633 | NA | NA | PIGSENSEKTTMPLW | PIGSENSEKTTMPLW | 15 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 853.3911+2 | NA | NA |
| FMDB99 | 26877633 | NA | NA | IGSENSEKTTMPLW | IGSENSEKTTMPLW | 14 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 807.8565+2 | NA | NA |
| FMDB100 | 26877633 | NA | NA | SENSEKTTMPLW | SENSEKTTMPLW | 12 | Skimmed Milk | αS1-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 711.8127+2 | NA | NA |
| FMDB101 | 26877633 | NA | NA | EVIESPPEINTVQVTSTAV | EVIESPPEINTVQVTSTAV | 19 | Skimmed Milk | k-Casein | NA | 37C | 24h | NA | NA | NA | NA | Bifidobacterium longum KACC 91563 | peptidase | LC-ESI-TOF-MS/MS | 1017.995+2 | NA | NA |
| FMDB105 | 24135669 | NA | NA | VPP | VPP | 3 | Skimmed Milk | β-Casein | 4.6 | 37C | 18h | NA | NA | NA | NA | Lactobacillus helveticus DSM 13137 | peptidases | LC-MS | NA | NA | 9uM |
| FMDB106 | 24135669 | NA | NA | IPP | IPP | 3 | Skimmed Milk | β-Casein | 4.6 | 37C | 18h | NA | NA | NA | NA | Lactobacillus helveticus DSM 13137 | peptidases | LC-MS | NA | NA | 9uM |
| FMDB107 | 26996626 | NA | NA | PKHKLMPF | PKHKLMPF | 8 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 997.9 | NA | NA |
| FMDB108 | 26996626 | NA | NA | PKHKLMPF | PKHKLMPF | 8 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 997.9 | NA | NA |
| FMDB109 | 26996626 | NA | NA | PKHKLMPF | PKHKLMPF | 8 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 997.9 | NA | NA |
| FMDB110 | 26996626 | NA | NA | PKHKLMPF | PKHKLMPF | 8 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 997.9 | NA | NA |
| FMDB111 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB112 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB113 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB114 | 26996626 ; 16899668 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | Anti-hypertensive | In vivo | spontaneously Hypertensive Rats | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1038.7 | NA | NA |
| FMDB115 | 26996626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1151.8 | NA | NA |
| FMDB116 | 26996626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1151.8 | NA | NA |
| FMDB117 | 26996626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1151.8 | NA | NA |
| FMDB118 | 26996626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1151.8 | NA | NA |
| FMDB119 | 26996626 | NA | NA | LGPVRGPFPIIV | LGPVRGPFPIIV | 12 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1265.1 | NA | NA |
| FMDB120 | 26996626 | NA | NA | LGPVRGPFPIIV | LGPVRGPFPIIV | 12 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1265.1 | NA | NA |
| FMDB121 | 26996626 | NA | NA | LGPVRGPFPIIV | LGPVRGPFPIIV | 12 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1265.1 | NA | NA |
| FMDB122 | 26996626 | NA | NA | LGPVRGPFPIIV | LGPVRGPFPIIV | 12 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1265.1 | NA | NA |
| FMDB123 | 26996626 | NA | NA | MHQPHQPLPPT | MHQPHQPLPPT | 11 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1283.1 | NA | NA |
| FMDB124 | 26996626 | NA | NA | VLGPVRGPFP | VLGPVRGPFP | 10 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1363.6 | NA | NA |
| FMDB125 | 26996626 | NA | NA | WMHQPHQPLPPT | WMHQPHQPLPPT | 12 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1469.3 | NA | NA |
| FMDB126 | 26996626 | NA | NA | WMHQPHQPLPPT | WMHQPHQPLPPT | 12 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1469.3 | NA | NA |
| FMDB127 | 26996626 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Milk | αS1-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1665.5 | NA | NA |
| FMDB128 | 26996626 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1665.5 | NA | NA |
| FMDB129 | 26996626 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1665.5 | NA | NA |
| FMDB130 | 26996626 | NA | NA | RPKHPIKHQGLPQE | RPKHPIKHQGLPQE | 14 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1665.5 | NA | NA |
| FMDB131 | 26996626 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1881.3 | NA | NA |
| FMDB132 | 26996626 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1881.3 | NA | NA |
| FMDB133 | 26996626 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1881.3 | NA | NA |
| FMDB134 | 26996626 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1881.3 | NA | NA |
| FMDB135 | 26996626; 20397193 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | Immunomodulatory | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1994.3 | NA | NA |
| FMDB136 | 26996626; 20397193 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | Immunomodulatory | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1994.3 | NA | NA |
| FMDB137 | 26996626; 20397193 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | Immunomodulatory | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1994.3 | NA | NA |
| FMDB138 | 26996626; 20397193 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | Immunomodulatory | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 1994.3 | NA | NA |
| FMDB139 | 26996626 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2107.4 | NA | NA |
| FMDB140 | 26996626 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2107.4 | NA | NA |
| FMDB141 | 26996626 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2107.4 | NA | NA |
| FMDB142 | 26996626 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2107.4 | NA | NA |
| FMDB143 | 26996626 ; 16899668 | NA | NA | RPKHPIKHQGLPQEVLNEN | RPKHPIKHQGLPQEVLNEN | 19 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2235 | NA | NA |
| FMDB144 | 26996626 ; 16899668 | NA | NA | RPKHPIKHQGLPQEVLNEN | RPKHPIKHQGLPQEVLNEN | 19 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2235 | NA | NA |
| FMDB145 | 26996626 ; 16899668 | NA | NA | RPKHPIKHQGLPQEVLNEN | RPKHPIKHQGLPQEVLNEN | 19 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2235 | NA | NA |
| FMDB146 | 26996626 | NA | NA | FLLYQEPVLGPVRGPFPIIV | FLLYQEPVLGPVRGPFPIIV | 20 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2254.3 | NA | NA |
| FMDB147 | 26996626 | NA | NA | MKPWIQPKTKVIPYVRYL | MKPWIQPKTKVIPYVRYL | 18 | Milk | αS2-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2260.37 | NA | NA |
| FMDB148 | 26996626 ; 16899668 | NA | NA | RPKHPIKHQGLPQEVLNENL | RPKHPIKHQGLPQEVLNENL | 20 | Milk | αS1-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2348.3 | NA | NA |
| FMDB149 | 26996626 | NA | NA | RPKHPIKHQGLPQEVLNENL | RPKHPIKHQGLPQEVLNENL | 20 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2348.3 | NA | NA |
| FMDB150 | 26996626 | NA | NA | RPKHPIKHQGLPQEVLNENL | RPKHPIKHQGLPQEVLNENL | 20 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2348.3 | NA | NA |
| FMDB151 | 26996626 | NA | NA | RPKHPIKHQGLPQEVLNENL | RPKHPIKHQGLPQEVLNENL | 20 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2348.3 | NA | NA |
| FMDB152 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMP | LSQSKVLPVPQKAVPYPQRDMP | 22 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2479.2 | NA | NA |
| FMDB153 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMP | LSQSKVLPVPQKAVPYPQRDMP | 22 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2479.2 | NA | NA |
| FMDB154 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMP | LSQSKVLPVPQKAVPYPQRDMP | 22 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2479.2 | NA | NA |
| FMDB155 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMP | LSQSKVLPVPQKAVPYPQRDMP | 22 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2479.2 | NA | NA |
| FMDB156 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 3.83 ± 0.2 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB157 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 4.27 ± 0.15 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB158 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 4.32 ± 0.6 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB159 | 26996626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Milk | αS1-Casein | 4.39± 0.22 | 41c | 48h | Anti-microbial against S.aureus | In vivo | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2764.4 | NA | NA |
| FMDB160 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQA | LSQSKVLPVPQKAVPYPQRDMPIQA | 25 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2790.8 | NA | NA |
| FMDB161 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAF | LSQSKVLPVPQKAVPYPQRDMPIQAF | 26 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2938.6 | NA | NA |
| FMDB162 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAF | LSQSKVLPVPQKAVPYPQRDMPIQAF | 26 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2938.6 | NA | NA |
| FMDB163 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAF | LSQSKVLPVPQKAVPYPQRDMPIQAF | 26 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2938.6 | NA | NA |
| FMDB164 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAF | LSQSKVLPVPQKAVPYPQRDMPIQAF | 26 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 2938.6 | NA | NA |
| FMDB165 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAFL | LSQSKVLPVPQKAVPYPQRDMPIQAFL | 27 | Milk | β-Casein | 3.83 ± 0.2 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3051.3 | NA | NA |
| FMDB166 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAFL | LSQSKVLPVPQKAVPYPQRDMPIQAFL | 27 | Milk | β-Casein | 4.27 ± 0.15 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3051.3 | NA | NA |
| FMDB167 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAFL | LSQSKVLPVPQKAVPYPQRDMPIQAFL | 27 | Milk | β-Casein | 4.32 ± 0.6 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3051.3 | NA | NA |
| FMDB168 | 26996626 | NA | NA | LSQSKVLPVPQKAVPYPQRDMPIQAFL | LSQSKVLPVPQKAVPYPQRDMPIQAFL | 27 | Milk | β-Casein | 4.39± 0.22 | 41c | 48h | NA | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3051.3 | NA | NA |
| FMDB169 | 26996626; 10434050 | NA | NA | VYQHQKAMKPWIQPKTKVIPYVRYL | VYQHQKAMKPWIQPKTKVIPYVRYL | 25 | Milk | αS2-Casein | 3.83 ± 0.2 | 41c | 48h | Antibacterial | NA | NA | NA | Lactobacillus gasseri 505 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3115.4 | NA | NA |
| FMDB170 | 26996626; 10434050 | NA | NA | VYQHQKAMKPWIQPKTKVIPYVRYL | VYQHQKAMKPWIQPKTKVIPYVRYL | 25 | Milk | αS2-Casein | 4.27 ± 0.15 | 41c | 48h | Antibacterial | NA | NA | NA | Lactobacillus gasseri 545 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3115.4 | NA | NA |
| FMDB171 | 26996626; 10434050 | NA | NA | VYQHQKAMKPWIQPKTKVIPYVRYL | VYQHQKAMKPWIQPKTKVIPYVRYL | 25 | Milk | αS2-Casein | 4.32 ± 0.6 | 41c | 48h | Antibacterial | NA | NA | NA | Lactobacillus gasseri 559 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3115.4 | NA | NA |
| FMDB172 | 26996626; 10434050 | NA | NA | VYQHQKAMKPWIQPKTKVIPYVRYL | VYQHQKAMKPWIQPKTKVIPYVRYL | 25 | Milk | αS2-Casein | 4.39± 0.22 | 41c | 48h | Antibacterial | NA | NA | NA | Lactobacillus gasseri 575 and Cudrania tricuspidata (CT) leaf extract | proteinases and peptidases of lactobacillus | MALDI-TOF/MS/MS | 3115.4 | NA | NA |
| FMDB178 | NA | pan05 | Antihypertensive peptides from skimmed Milk hydrolysate digested by cell-free extract of Lactobacillus helveticus JCM1004 | VPP | VPP | 3 | Skimmed Milk | β-Casein &k Casein | 6.5-7.0 | 37c | 20h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substarte | Lactobacillus helveticus JCM1004 | proteinase and peptidase | RPHPLC and protein sequencer | NA | NA | 9.13 ± 0.21 uM |
| FMDB179 | NA | pan05 | NA | IPP | IPP | 3 | Skimmed Milk | β-Casein &k Casein | 6.5-7.0 | 37c | 20h | Ace-inhibitory;Anti-hypertensive | In vitro and In vivo | spontaneously Hypertensive Rats | Spectrophotometric assay using HHL as substarte | Lactobacillus helveticus JCM1004 | proteinase and peptidase | RPHPLC and protein sequencer | NA | NA | 5.15 ± 0.17 UM |
| FMDB204 | NA | pan10 | Optimization of sour Milk fermentation for the production of ACE-inhibitory peptides and purification of a novel peptide from Whey protein hydrolysate | RLSFNP | RLSFNP | 6 | Whey protein | Bovine Beta lactoglobulin | 7.5 | 39C | 20h | Ace-inhibitory | In vitro | NA | Spectrophotometric asay using HHL as substrate | Lb. helveticus LB10 | proteinase and peptidase | RPHLC &triple-quadruple mas spectrometer ESI-MS/MS | NA | 732.84Da | 177.39 μm. |
| FMDB205 | 22103626; 17430184 | NA | NA | VKEAMAPK | VKEAMAPK | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Antioxidant | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB206 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB207 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB208 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB209 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB210 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB211 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB212 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB213 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB214 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB215 | 22103626;8201050 | NA | NA | SKVLPVPQ | SKVLPVPQ | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB216 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB217 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB218 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB219 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB220 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB221 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB222 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB223 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB224 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB225 | 22103626;8880454 | NA | NA | KVLPVPQ | KVLPVPQ | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB226 | 22103626;11170591 | NA | NA | KVLPVPQK | KVLPVPQK | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | LOX inhibitor | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB227 | 22103626;11170591 | NA | NA | KVLPVPQK | KVLPVPQK | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | LOX inhibitor | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB228 | 22103626;11170591 | NA | NA | KVLPVPQK | KVLPVPQK | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | LOX inhibitor | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB229 | 22103626;11170591 | NA | NA | KVLPVPQK | KVLPVPQK | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | LOX inhibitor | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB230 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB231 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB232 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB233 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB234 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB235 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB236 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB237 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB238 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB239 | 22103626;8201050 | NA | NA | RDMPIQAF | RDMPIQAF | 8 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB240 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB241 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB242 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB243 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB244 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB245 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB246 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB247 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB248 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB249 | 22103626;8201050;17407211 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory;Immunomodulatory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB250 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB251 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB252 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB253 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB254 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB255 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB256 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB257 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB258 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB259 | 22103626;1427989 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Mitogene | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB260 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB261 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB262 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB263 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB264 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB265 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB266 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB267 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB268 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB269 | 22103626 | NA | NA | YQEPVL | YQEPVL | 6 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB270 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB271 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB272 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB273 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB274 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB275 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB276 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB277 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB278 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB279 | 22103626;8201050 | NA | NA | YQEPVLGPVR | YQEPVLGPVR | 10 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB280 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB281 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB282 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB283 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB284 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB285 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB286 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB287 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB288 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB289 | 22103626;11694622 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB290 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB291 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB292 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB293 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB294 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB295 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB296 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB297 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB298 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB299 | 22103626;17483275 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB300 | 22103626;16448175 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB301 | 22103626;16448175 | NA | NA | VRGPFPIIV | VRGPFPIIV | 9 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB302 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB303 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB304 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB305 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB306 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB307 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB308 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB309 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB310 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB311 | 22103626;17483275 | NA | NA | GPFPIIV | GPFPIIV | 7 | Bovine sodium Caseinate | β-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB312 | 22103626;12417344 | NA | NA | FALPQYLK | FALPQYLK | 8 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB313 | 22103626;8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB314 | 22103626;8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB315 | 22103626;8880454 | NA | NA | AMKPWIQPK | AMKPWIQPK | 9 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB316 | 22103626;8880454 | NA | NA | MKPWIQPK | MKPWIQPK | 8 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB317 | 22103626;8880454 | NA | NA | MKPWIQPK | MKPWIQPK | 8 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB318 | 22103626;8880454 | NA | NA | MKPWIQPK | MKPWIQPK | 8 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB319 | 22103626;8880454 | NA | NA | TKVIP | TKVIP | 5 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB320 | 22103626;8880454 | NA | NA | TKVIP | TKVIP | 5 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB321 | 22103626;8880454 | NA | NA | TKVIP | TKVIP | 5 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB322 | 22103626 | NA | NA | PYVRYL | PYVRYL | 6 | Bovine sodium Caseinate | αS2-Casein | NA | 42C | 4h | Ace-inhibitory;Antioxidant | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB323 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB324 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATE 19 PB8 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB325 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB326 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB327 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB302 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB328 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB329 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ 404 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB330 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus CNRZ445 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB331 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus ATCC19258 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB332 | 22103626;10908049 | NA | NA | RPKHPIKHQ | RPKHPIKHQ | 9 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Ace-inhibitory | NA | NA | NA | S.thermophilus HAD 8α | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB333 | 22103626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus LMD-9 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB334 | 22103626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus PB385 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB335 | 22103626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus 4F44 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB336 | 22103626;8603791 | NA | NA | RPKHPIKHQGLPQEVLNENLLRF | RPKHPIKHQGLPQEVLNENLLRF | 23 | Bovine sodium Caseinate | αS1-Casein | NA | 42C | 4h | Immunomodulatory;Antibacterial | NA | NA | NA | S.thermophilus Y4 | proteinase and peptidase | LC-ESI-MS/MS. | NA | NA | NA |
| FMDB338 | 21787916 | NA | NA | YQEPVLGPVRGPFPI | YQEPVLGPVRGPFPI | 15 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 835.0 (+2) | 1668.04 | 5.3 ± 0.10ug/ml |
| FMDB339 | 21787916 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 941.4 (+2) | 1880.28 | 5.3 ± 0.10ug/ml |
| FMDB340 | 21787916 | NA | NA | EVLNENLLRF | EVLNENLLRF | 10 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 624 (+2) | 1236.82 | 5.3 ± 0.10ug/ml |
| FMDB341 | 21787916 | NA | NA | FVAPFPEVFGK | FVAPFPEVFGK | 11 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lactobacillus casei | proteinase and peptidase | LC-ESI-MS | 619.4 (+2) | 1245.86 | 5.3 ± 0.10ug/ml |
| FMDB342 | 21787916 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 941.4 (+2) | 1880.28 | 10.4 ± 0.40 ug/ml |
| FMDB343 | 21787916 | NA | NA | RPKHPIKHQGLPQEV | RPKHPIKHQGLPQEV | 15 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 945.2 (+2) | 1893.38 | 10.4 ± 0.40 ug/ml |
| FMDB344 | 21787916 | NA | NA | RPKHPIKHQGLPQEVLNENLLR | RPKHPIKHQGLPQEVLNENLLR | 22 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 922.3 (+2) | 2763.87 | 10.4 ± 0.40 ug/ml |
| FMDB345 | 21787916 | NA | NA | FVAPFPEVFGK | FVAPFPEVFGK | 11 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 619.5 (+2) | 1236.9 | 10.4 ± 0.40 ug/ml |
| FMDB346 | 21787916 | NA | NA | EVLNENLLRF | EVLNENLLRF | 10 | mexican frescocheese WSE | αS1-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 624.2 (+2) | 1246.22 | 10.4 ± 0.40 ug/ml |
| FMDB347 | 21787916 | NA | NA | YQEPVLGPVRGPF | YQEPVLGPVRGPF | 13 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 729.9 (+2) | 1457.8 | 10.4 ± 0.40 ug/ml |
| FMDB348 | 21787916 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | mexican frescocheese WSE | β-Casein | NA | 34C &4C | After 2h incbtn rennet addn then coagultn for 1h & stoarge 4C after that5d cheese ripening | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Enterococcus faecium | proteinase and peptidase | LC-ESI-MS | 941.7 (+2) | 1881.46 | 10.4 ± 0.40 ug/ml |
| FMDB349 | 22901481 | NA | NA | DDQNPH | DDQNPH | 6 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 362.9 (+2) | 723.9 | 0.076 ±004ug/ml |
| FMDB350 | 22901481 | NA | NA | LDDDLTDDI | LDDDLTDDI | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 517.4(+2) | 1032.8 | 0.076 ±004ug/ml |
| FMDB351 | 22901481 | NA | NA | YPSYGL | YPSYGL | 6 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 350.3(+2) | 698.6 | 0.076 ±004ug/ml |
| FMDB352 | 22901481 | NA | NA | HPHPHLSFMAIPP | HPHPHLSFMAIPP | 13 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 740.5(+2) | 1479 | 0.076 ±004ug/ml |
| FMDB353 | 22901481 | NA | NA | YDTQAIVQ | YDTQAIVQ | 8 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 518.8(+2) | 1035.7 | 0.076 ±004ug/ml |
| FMDB354 | 22901481 | NA | NA | DDDLTDDIMCV | DDDLTDDIMCV | 11 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 462.3(+3) | 1386.8 | 0.076 ±004ug/ml |
| FMDB355 | 22901481 | NA | NA | YPSYG | YPSYG | 5 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 586.7(+1) | 585.9 | 0.076 ±004ug/ml |
| FMDB356 | 22901481 | NA | NA | AESIS | AESIS | 5 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | αS1-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 506.9(+3) | 505.9 | NA |
| FMDB357 | 22901481 | NA | NA | SITRINK | SITRINK | 7 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 416.1(+2) | 830.1 | NA |
| FMDB358 | 22901481 | NA | NA | HIQKEDVPS | HIQKEDVPS | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | αS1-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 526.7(+2) | 1051.4 | NA |
| FMDB359 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 453(+2) | 904.1 | NA |
| FMDB360 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 453.2(+2) | 904.3 | NA |
| FMDB361 | 22901481 | NA | NA | NAVPITPTLN | NAVPITPTLN | 10 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | αS2-CN | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 520.2(+2) | 1038.4 | NA |
| FMDB362 | 22901481 | NA | NA | SLPQNIPPL | SLPQNIPPL | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 489.6(+2) | 977.1 | NA |
| FMDB363 | 22901481 | NA | NA | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 859.4(+2) | 1716.9 | NA |
| FMDB364 | 22901481 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 576.2(+2) | 1150.4 | NA |
| FMDB365 | 22901481 | NA | NA | SLPQNIPPL | SLPQNIPPL | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 489.7(+2) | 977.2 | NA |
| FMDB366 | 22901481 | NA | NA | YIPIQYVLS | YIPIQYVLS | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 548.2(+2) | 1094.4 | NA |
| FMDB367 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 453.5(+2) | 904.4 | 0.034 ± 0.002 μg/mL |
| FMDB368 | 22901481 | NA | NA | PEINTVQVTSTAV | PEINTVQVTSTAV | 13 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 453.2(+3) | 1356.7 | 0.034 ± 0.002 μg/mL |
| FMDB369 | 22901481 | NA | NA | GYLAVA | GYLAVA | 6 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | Serotransferrin | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50571 | proteinase and peptidase | LC-ESI-MS | 198.3(+3) | 591.8 | 0.034 ± 0.002 μg/mL |
| FMDB370 | 22901481 | NA | NA | DVENLHLPLPLL | DVENLHLPLPLL | 12 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 686.6(+2) | 1371.53 | 0.041 ± 0.003 ug/ml |
| FMDB371 | 22901481 | NA | NA | YPSYGL | YPSYGL | 6 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 350.2(+2) | 698.6 | 0.041 ± 0.003 ug/ml |
| FMDB372 | 22901481 | NA | NA | ENGEC | ENGEC | 5 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-lactoglobulin | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 550.9(+3) | 549.8 | 0.041 ± 0.003 ug/ml |
| FMDB373 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 453.1(+2) | 904.2 | 0.084 ± 0.003 μg/mL |
| FMDB374 | 22901481 | NA | NA | TVQVTSTAV | TVQVTSTAV | 9 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | k-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 453.1(+2) | 904.2 | NA |
| FMDB375 | 22901481 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | β-Casein | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 576.3(+2) | 1150.5 | NA |
| FMDB376 | 22901481 | NA | NA | TDDIMCVK | TDDIMCVK | 8 | Reconstituted Non fat dryMilk/ WSEof Fermented Milk | α-LA | NA | 30 C | 48h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Lc. lactis NRRL B-50572 | proteinase and peptidase | LC-ESI-MS | 922.4(+1) | 922.4 | NA |
| FMDB377 | 24135669 | NA | NA | LVYPFP | LVYPFP | 6 | probiotic femented Milk | β-Casein | 6.67 | 37C | 24h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Bifidobacterium bifidum MF 20/5 | proteinase and peptidase | LCMS | NA | NA | 132uM |
| FMDB378 | 24135669 | NA | NA | LPLP | LPLP | 4 | probiotic femented Milk | β-Casein | 6.67 | 37C | 24h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | Bifidobacterium bifidum MF 20/5 | proteinase and peptidase | LCMS | NA | NA | 750uM |
| FMDB379 | 24135669;11170591 | NA | NA | VLPVPQK | VLPVPQK | 7 | probiotic femented Milk | β-Casein | 6.67 | 37C | 24h | Ace-inhibitory;Antioxidant | In vitro | NA | spectrophotometeric assay using HHL as substrate | Bifidobacterium bifidum MF 20/5 | proteinase and peptidase | LCMS | NA | NA | NA |
| FMDB380 | 24135669 | NA | NA | IPP | IPP | 3 | NA | NA | 4.6 | 37C | 24h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | L. helveticus DSM13137 | proteinase and peptidase | LCMS | NA | NA | NA |
| FMDB381 | 24135669 | NA | NA | VPP | VPP | 3 | NA | NA | 4.6 | 37C | 24h | Ace-inhibitory | In vitro | NA | spectrophotometeric assay using HHL as substrate | L. helveticus DSM13137 | proteinase and peptidase | LCMS | NA | NA | NA |
| FMDB705 | 22156436 | NA | NA | MAPAAVAAAEAGSK | MAPAAVAAAEAGSK | 14 | Whole wheat flour | NA | 3.40 ± 0.03 | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS47 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1243.623 | NA |
| FMDB706 | 22156436 | NA | NA | DNIPIVIR | DNIPIVIR | 8 | Whole wheat flour | NA | 3.40 ± 0.03 | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS48 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 938.5549 | NA |
| FMDB707 | 22156436 | NA | NA | AIAGAGVLSGYDQLQILFFGK | AIAGAGVLSGYDQLQILFFGK | 21 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS49 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2167.1677 | NA |
| FMDB708 | 22156436 | NA | NA | GNQEKVLELVQR | GNQEKVLELVQR | 12 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS50 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1411.7783 | NA |
| FMDB709 | 22156436 | NA | NA | PAGSAAGAAP | PAGSAAGAAP | 10 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS51 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 769.8311 | NA |
| FMDB710 | 22156436 | NA | NA | EALEAMFL | EALEAMFL | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS52 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 924.1021 | NA |
| FMDB711 | 22156436 | NA | NA | AAGAAAAARSAGQCGR | AAGAAAAARSAGQCGR | 16 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS53 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1387.6738 | NA |
| FMDB712 | 22156436 | NA | NA | ITFAAYRR | ITFAAYRR | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS54 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 998.1621 | NA |
| FMDB713 | 22156436 | NA | NA | HPVPPKKK | HPVPPKKK | 8 | Spelt | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS55 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 912.2177 | NA |
| FMDB714 | 22156436 | NA | NA | VFVDEGLEVLGWRPVPFNVSVVGRNAK | VFVDEGLEVLGWRPVPFNVSVVGRNAK | 27 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS56 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2982.608 | NA |
| FMDB715 | 22156436 | NA | NA | RLSLPAGAPVTVAVSP | RLSLPAGAPVTVAVSP | 16 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS57 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1535.8101 | NA |
| FMDB716 | 22156436 | NA | NA | NANGELCPNNMCCSQWGYCGLGSEFCGNGCQSGACCPEK | NANGELCPNNMCCSQWGYCGLGSEFCGNGCQSGACCPEK | 39 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS58 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 4033.4843 | NA |
| FMDB717 | 22156436 | NA | NA | LCPVHRAADL | LCPVHRAADL | 10 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS59 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1095.3231 | NA |
| FMDB718 | 22156436 | NA | NA | PAEMVAAALDR | PAEMVAAALDR | 11 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS60 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1484.7511 | NA |
| FMDB719 | 22156436 | NA | NA | KVALMSAGSMH | KVALMSAGSMH | 11 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS61 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1131.2679 | NA |
| FMDB720 | 22156436 | NA | NA | DLADIPQQQRLMAGLALVVATVIFLK | DLADIPQQQRLMAGLALVVATVIFLK | 26 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS62 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2822.6092 | NA |
| FMDB721 | 22156436 | NA | NA | KNGSIFNSPSATAATIIHGHNYSGLAYLDFVTSK | KNGSIFNSPSATAATIIHGHNYSGLAYLDFVTSK | 34 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS63 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 3580.795 | NA |
| FMDB722 | 22156436 | NA | NA | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK | GTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPTGK | 53 | Rye | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS64 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 5338.5201 | NA |
| FMDB723 | 22156436 | NA | NA | YEWEPTVPNFDVAKDVTDM | YEWEPTVPNFDVAKDVTDM | 19 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS65 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2255.0093 | NA |
| FMDB724 | 22156436 | NA | NA | GVSNAAVVAGGH | GVSNAAVVAGGH | 12 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS66 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1037.5254 | NA |
| FMDB725 | 22156436 | NA | NA | DAQEFKR | DAQEFKR | 7 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS67 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 892.4403 | NA |
| FMDB726 | 22156436 | NA | NA | PPGPGPGPPPPPGAAGRGGGG | PPGPGPGPPPPPGAAGRGGGG | 21 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS68 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 1704.8721 | NA |
| FMDB727 | 22156436 | NA | NA | HKEMQAIFDVYIMFIN | HKEMQAIFDVYIMFIN | 16 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS69 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 2000.3734 | NA |
| FMDB728 | 22156436 | NA | NA | TGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR | TGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQGAAAANAPAVPVVVVDTQEAGIR | 57 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS70 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 5124.5196 | NA |
| FMDB729 | 22156436 | NA | NA | DTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR | DTAAGYVAPPDPAVSTGDYGLAGAEAPHPHESAVMSGAAAAAVAPGGEAYTR | 52 | kamut | NA | 3.40 ± 0.03 to 3.88 ± 0.05. | 37C | 24h | Antioxidant | In vitro | NA | DPPH radical-scavenging activity & Inhibition of linoleic acid autoxidation | Lactobacillus alimentarius 15 M, Lactobacillus brevis14G, Lactobacillus sanfranciscensis 7A, and Lactobacillus hilgardii 51B L.sanfranciscensis LS3, LS10, LS19, LS23, LS38, and LS71 | proteinase and peptidase | nano-LC-ESIMS/ MS | NA | 4921.2889 | NA |
| FMDB792 | 25829629 | NA | NA | TYKEE | TYKEE | 5 | skim Milk Yogurt | αS2-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B94 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 12.41+/-0.46ug/ml |
| FMDB793 | 25829629 | NA | NA | IPP | IPP | 3 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B95 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 11.6uM |
| FMDB794 | 25829629 | NA | NA | IPP | IPP | 3 | skim Milk Yogurt | k-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | spectrophotometric assay using HHL as substrate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B96 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 11.6uM |
| FMDB795 | 25829629 | NA | NA | YQQPVL | YQQPVL | 6 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B96 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 6.09+/-0.46ug/ml |
| FMDB796 | 25829629 | NA | NA | RINKK | RINKK | 5 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B97 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 12.05+/-0.93ug/ml |
| FMDB797 | 25829629 | NA | NA | SLPQN | SLPQN | 5 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B98 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 5.29±0.55ug/ml |
| FMDB798 | 25829629 | NA | NA | VPP | VPP | 3 | skim Milk Yogurt | β-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B99 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 8.4uM |
| FMDB799 | 25829629 | NA | NA | ARHPH | ARHPH | 5 | skim Milk Yogurt | k-Casein | 4.5 | 42C for L. delbrueckii ssp. bulgaricus Lb1466 and 37C for others | 12h | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | L. delbrueckii ssp. bulgaricus Lb1466 and S. thermophilus St1342 and L. acidophilus L10, L. casei L26 and B. lactis B100 | proteinase and peptidase | RPHPLC and automated Edman degradation on Applied Biosystem Procise protein/peptide sequencer | NA | NA | 9.64±3.67ug/ml |
| FMDB800 | 16162521 | NA | NA | LEIVPK | LEIVPK | 6 | caprine kefir | αS1-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 697.4 ± 0.06 | >1000 µM |
| FMDB801 | 16162521 | NA | NA | DKIHPF | DKIHPF | 6 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 755.4 ± 0.08 | >1000 µM |
| FMDB802 | 16162521 | NA | NA | KIHPFAQAQ | KIHPFAQAQ | 9 | caprine kefir | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1038.4 ± 0.02 | 132.6 ± 14.1 µM |
| FMDB803 | 16162521 | NA | NA | QLLKLK | QLLKLK | 6 | caprine kefir | αS1-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 741.5 ± 0.08 | 342.4 ± 32.1 µM |
| FMDB804 | 16162521 | NA | NA | LNVVGETVE | LNVVGETVE | 9 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 958.3 ± 0.04 | >1000 µM |
| FMDB805 | 16162521 | NA | NA | GVPKVKETMVPK | GVPKVKETMVPK | 12 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1311.5 ± 0.04 | 376.1 ± 36.9 |
| FMDB806 | 16162521 | NA | NA | GVPKVKETMVPKH | GVPKVKETMVPKH | 13 | caprine kefir | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1448.5 ± 0.08 | 223.2 ± 21.3 |
| FMDB807 | 16162521 | NA | NA | IPAIN | IPAIN | 5 | caprine kefir | k-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 526.4 ± 0.04 | 432.6 ± 41.6 |
| FMDB808 | 16162521 | NA | NA | GPFPILV | GPFPILV | 7 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 741.5 ± 0.04 | 424.0 ± 42.4 |
| FMDB809 | 16162521 | NA | NA | KFAWPQ | KFAWPQ | 6 | caprine kefir | αS2-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 775.5 ± 0.05 | 177.1 ± 14.9 |
| FMDB810 | 16162521 | NA | NA | TGPIPNSLPQ | TGPIPNSLPQ | 10 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1022.5 ± 0.02 | >1000 |
| FMDB811 | 16162521 | NA | NA | YPF | YPF | 3 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 425.2 ± 0.02 | >1000 |
| FMDB812 | 16162521 | NA | NA | HPFAQ | HPFAQ | 5 | caprine kefir | β-Casein | NA | NA | NA | NA | NA | NA | NA | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 598.4 ± 0.04 | 465.0 ± 43.4 |
| FMDB813 | 16162521 | NA | NA | ENLLRF | ENLLRF | 6 | caprine kefir | αS1-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 790.4 ± 0.06 | 82.4 ± 8.9 |
| FMDB814 | 16162521 | NA | NA | PYVRYL | PYVRYL | 6 | caprine kefir | αS2-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 809.4 ± 0.07 | 2.4 ± 0.2 |
| FMDB815 | 16162521 | NA | NA | LVYPFTGPIPN | LVYPFTGPIPN | 11 | caprine kefir | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | Lactococcus lactis, lactococcus cremoris, Lactococcus biovar. Diacetylactis, leuconostoc meenterides ssp. Cremoris, lacobacillus plantarum, lactobacillus casei, and the Kluveromyces marxianus var. fragilis | proteinase and peptidase | on line RP-HPLC-tandem Mass spectrometery | NA | 1216.5 ± 0.01 | 27.9 ± 2.3 |
| FMDB818 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus reuteri TMW 1.106 | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB819 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus reuteri TMW 1.106 | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB820 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus reuteri TMW 1.106 | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB821 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus reuteri TMW 1.106 | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB822 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5448 | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB823 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5448 | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB824 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5448 | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB825 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5448 | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB826 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus rossiae 34J | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB827 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus rossiae 34J | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB828 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus rossiae 34J | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB829 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus rossiae 34J | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB830 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus hammesii DSM 16381 | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB831 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus hammesii DSM 16381 | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB832 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus hammesii DSM 16381 | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB833 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus hammesii DSM 16381 | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB834 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5795 | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB835 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5795 | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB836 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5795 | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB837 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | L. reuteri LTH 5795 | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB838 | 21985248 | NA | NA | LQP | LQP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | ω-secalin;ω-gliadin,α-gliadin,γ gliadin,HMWglutein subunit,D-Hordein,γ hordein;C-hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus plantarum FUA 3002 | peptidase+fungal protease | LCMS/MS | 357 - 242 ( transition) | NA | 2µM |
| FMDB839 | 21985248 | NA | NA | LLP | LLP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ-75k-secalin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus plantarum FUA 3002 | peptidase+fungal protease | LCMS/MS | 342 - 116 ( transition) | NA | 57µM |
| FMDB840 | 21985248 | NA | NA | VPP | VPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | γ gliadin,HMWglutein subunit, γ hordein | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus plantarum FUA 3002 | peptidase+fungal protease | LCMS/MS | 312 - 213 ( transition) | NA | 5µM |
| FMDB841 | 21985248 | NA | NA | IPP | IPP | 3 | Rye Malt:wheat gluten/ barley hordein sourdough | α-gliadin, ω-gliadin | NA | 34c | 24h | Ace-inhibitory | BioInformatic analysis | NA | NA | Lactobacillus plantarum FUA 3002 | peptidase+fungal protease | LCMS/MS | 326 - 213 ( transition) | NA | 9µM |
| FMDB842 | 19994857 | NA | NA | AW | AW | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 10ug/ml |
| FMDB843 | 19994857 | NA | NA | GW | GW | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 30ug/ml |
| FMDB844 | 19994857 | NA | NA | AY | AY | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 48ug/ml |
| FMDB845 | 19994857 | NA | NA | SY | SY | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 67ug/ml |
| FMDB846 | 19994857 | NA | NA | GY | GY | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 67ug/ml |
| FMDB847 | 19994857 | NA | NA | AF | AF | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 190ug/ml |
| FMDB848 | 19994857 | NA | NA | VP | VP | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 480ug/ml |
| FMDB849 | 19994857 | NA | NA | AI | AI | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 690ug/ml |
| FMDB850 | 19994857 | NA | NA | VG | VG | 2 | Fermented soyabean seasoning | NA | NA | 45C | 5days | Ace-inhibitory | In vitro and In vivo | spontaneously Hypertensive Rats | ACE color kit conatining p-hydroxybenzoylglycyl-L-histidyl-L-leucine as substrate | A. sojae | peptidase | LCMS/MS | NA | NA | 1100ug/ml |
| FMDB851 | 18160180 | NA | NA | AF | AF | 2 | salt free soy sauce | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | NA | A. sojae | peptidase | Two step RPHPLC | NA | NA | 165.3uM |
| FMDB852 | 18160180 | NA | NA | IF | IF | 2 | salt free soy sauce | NA | NA | NA | NA | Ace-inhibitory | In vitro | NA | NA | A. sojae | peptidase | Two step RPHPLC | NA | NA | 65.8uM |
| FMDB862 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1140.7g/mol | 0.25mg/ml |
| FMDB863 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIK | RPKHPIK | 7 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 877g/mol | 0.25mg/ml |
| FMDB864 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPI | RPKHPI | 6 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 745.4g/mol | 0.25mg/ml |
| FMDB865 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | DKIHPF | DKIHPF | 6 | WSE of Cheddar cheese | β-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 755.4g/mol | 0.14mg/ml |
| FMDB866 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1053.3g/mol | 0.11mg/ml |
| FMDB867 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | KKYKVPQLE | KKYKVPQLE | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1132.4g/mol | 0.11mg/ml |
| FMDB868 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | WSE of Cheddar cheese | β-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei LAFTI® L26. | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1881.1g/mol | 0.14mg/ml |
| FMDB869 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1140.7g/mol | 0.18mg/ml |
| FMDB870 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIK | RPKHPIK | 7 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 877g/mol | 0.18mg/ml |
| FMDB871 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPI | RPKHPI | 6 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 745.4g/mol | 0.18mg/ml |
| FMDB872 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | DKIHPF | DKIHPF | 6 | WSE of Cheddar cheese | β-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 755.4g/mol | 0.12mg/ml |
| FMDB873 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1053.3g/mol | 0.09mg/ml |
| FMDB874 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | KKYKVPQLE | KKYKVPQLE | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1132.4g/mol | 0.09mg/ml |
| FMDB875 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | WSE of Cheddar cheese | β-Casein | NA | 4c | 24wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris and Lb. casei 279 | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1881.1g/mol | 0.17mg/ml |
| FMDB876 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIKHQ | RPKHPIKHQ | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1140.7g/mol | 0.20mg/ml |
| FMDB877 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPIK | RPKHPIK | 7 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 877g/mol | 0.20mg/ml |
| FMDB878 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | RPKHPI | RPKHPI | 6 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 745.4g/mol | 0.20mg/ml |
| FMDB879 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | DKIHPF | DKIHPF | 6 | WSE of Cheddar cheese | β-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 755.4g/mol | 0.16mg/ml |
| FMDB880 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | FVAPFPEVF | FVAPFPEVF | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1053.3g/mol | 0.12mg/ml |
| FMDB881 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | KKYKVPQLE | KKYKVPQLE | 9 | WSE of Cheddar cheese | αS1-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1132.4g/mol | 0.12mg/ml |
| FMDB882 | NA | ong07 | Angiotensin converting enzyme-inhibitory activity in Cheddar cheeses made with the addition of probiotic Lactobacillus casei sp. | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | WSE of Cheddar cheese | β-Casein | NA | 4c | 36wk | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using hippuryl-L-histidyl-L-leucine substrate | L. lactis subsp. lactis and L. lactis subsp. Cremoris | proteinase and peptidases | RPHPLC; Edman degradation method using protein sequencer and MALDI-TOF-MS | NA | 1881.1g/mol | 0.14mg/ml |
| FMDB1031 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | IQP | IQP | 3 | rye malt gluten sourdough | NA | NA | 37c | 96h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | NA |
| FMDB1032 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | LQP | LQP | 3 | rye malt gluten sourdough | NA | NA | 37c | 96h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | 2umol/l |
| FMDB1033 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | IIP | IIP | 3 | rye malt gluten sourdough | NA | NA | 37c | 96h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | NA |
| FMDB1034 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | LIP | LIP | 3 | rye malt gluten sourdough | NA | NA | 37c | 96h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | 2.5umol/l |
| FMDB1035 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | LLP | LLP | 3 | rye malt gluten sourdough | NA | NA | 37c | 96h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | 57umol/l |
| FMDB1036 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | IPP | IPP | 3 | rye malt gluten sourdough | NA | NA | 37c | 96h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | 9umol/l |
| FMDB1037 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | LPP | LPP | 3 | rye malt gluten sourdough | NA | NA | 37c | 96h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | 9.6umol/l |
| FMDB1038 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | VPP | VPP | 3 | rye malt gluten sourdough | NA | NA | 37c | 96h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | 5umol/l |
| FMDB1039 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | IQP | IQP | 3 | wheat sourdough | NA | NA | 37c | 24h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | NA |
| FMDB1040 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | LQP | LQP | 3 | wheat sourdough | NA | NA | 37c | 24h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | 2umol/l |
| FMDB1041 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | IIP | IIP | 3 | wheat sourdough | NA | NA | 37c | 24h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | NA |
| FMDB1042 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | LIP | LIP | 3 | wheat sourdough | NA | NA | 37c | 24h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | 2.5umol/l |
| FMDB1043 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | LLP | LLP | 3 | wheat sourdough | NA | NA | 37c | 24h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | 57umol/l |
| FMDB1044 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | IPP | IPP | 3 | wheat sourdough | NA | NA | 37c | 24h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | 9umol/l |
| FMDB1045 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | LPP | LPP | 3 | wheat sourdough | NA | NA | 37c | 24h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | 9.6umol/l |
| FMDB1046 | NA | zhao13 | Fate of ACE-inhibitory peptides during the bread-making process: Quantification of peptides in sourdough, bread crumb, steamed bread and soda crackers | VPP | VPP | 3 | wheat sourdough | NA | NA | 37c | 24h | Ace-inhibitory | NA | NA | NA | Lactobacillus reuteri TMW1.106 | peptidases | LC-MS/MS | NA | NA | 5umol/l |
| FMDB1072 | NA | smacchi98 | Peptides from several Italian cheeses inhibitory to proteolytic enzymes of lactic acid bacteria, Pseudomonas fluorescens ATCC 948 and to the angiotensin I-converting enzyme | LVYPFPGPIHNSLPQ | LVYPFPGPIHNSLPQ | 15 | WSE of Crescenza cheese | β-Casein | NA | NA | NA | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substrate | Lactobacillus delbrueckii ssp. bulgaricus B397, Streptococcus thermophilus 305, and Lactococcus lactis ssp. cremoris Wg2 | peptidases | NA | 835.0 (+2) | NA | NA |
| FMDB1129 | 23806758 | NA | NA | VGGASLKPEF | VGGASLKPEF | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 502.78+2 | NA | NA |
| FMDB1130 | 23806758 | NA | NA | VGLDTTKF | VGLDTTKF | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 440.75+2 | NA | NA |
| FMDB1131 | 23806758 | NA | NA | EVGGEALGRL | EVGGEALGRL | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 500.78+2 | NA | NA |
| FMDB1132 | 23806758 | NA | NA | QLGKAGIM | QLGKAGIM | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 417.27+2 | NA | NA |
| FMDB1133 | 23806758 | NA | NA | ASDPIL | ASDPIL | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 615.34+1 | NA | NA |
| FMDB1134 | 23806758 | NA | NA | ASDPILYRPVA | ASDPILYRPVA | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 601.34+2 | NA | NA |
| FMDB1135 | 23806758 | NA | NA | PILYRPVA | PILYRPVA | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 464.79+2 | NA | NA |
| FMDB1136 | 23806758 | NA | NA | SKHPGDFGAD | SKHPGDFGAD | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 515.73+2 | NA | NA |
| FMDB1137 | 23806758 | NA | NA | IVPIVE | IVPIVE | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 669.42+1 | NA | NA |
| FMDB1138 | 23806758 | NA | NA | AAVYKALSDHHIY | AAVYKALSDHHIY | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 496.6+3 | NA | NA |
| FMDB1139 | 23806758 | NA | NA | LSGGQSEEEASINL | LSGGQSEEEASINL | 14 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 717.37+2 | NA | NA |
| FMDB1140 | 23806758 | NA | NA | FISNHAY | FISNHAY | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 426.211+2 | NA | NA |
| FMDB1141 | 23806758 | NA | NA | SPLPVIPH | SPLPVIPH | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 430.26+2 | NA | NA |
| FMDB1142 | 23806758 | NA | NA | KLDVKGKRVVM | KLDVKGKRVVM | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 430.27+2 | NA | NA |
| FMDB1143 | 23806758 | NA | NA | MSHLGRPD | MSHLGRPD | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 464.72+2 | NA | NA |
| FMDB1144 | 23806758 | NA | NA | IKWGDAGATY | IKWGDAGATY | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 541.28+2 | NA | NA |
| FMDB1145 | 23806758 | NA | NA | GDAGATY | GDAGATY | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 654.28 | NA |
| FMDB1146 | 23806758 | NA | NA | VVESTGVF | VVESTGVF | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 837.44 | NA |
| FMDB1147 | 23806758 | NA | NA | GYSNRVVDL | GYSNRVVDL | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 511.77+2 | NA | NA |
| FMDB1148 | 23806758 | NA | NA | AMQKIF | AMQKIF | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 377.2+2 | NA | NA |
| FMDB1149 | 23806758 | NA | NA | DSRGNPTVEVD | DSRGNPTVEVD | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 594.79+2 | NA | NA |
| FMDB1150 | 23806758 | NA | NA | KVVIGM | KVVIGM | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 331.7+2 | NA | NA |
| FMDB1151 | 23806758 | NA | NA | VVIGM | VVIGM | 5 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 534.3 | NA |
| FMDB1152 | 23806758 | NA | NA | IKNYPVVSIED | IKNYPVVSIED | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 638.85+2 | NA | NA |
| FMDB1153 | 23806758 | NA | NA | NTNHGRILL | NTNHGRILL | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 519.3+2 | NA | NA |
| FMDB1154 | 23806758 | NA | NA | GTHIAKTL | GTHIAKTL | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 420.75+2 | NA | NA |
| FMDB1155 | 23806758 | NA | NA | PSAVAKHFVA | PSAVAKHFVA | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 513.79+2 | NA | NA |
| FMDB1156 | 23806758 | NA | NA | VIQTGVD | VIQTGVD | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 731.4 | NA |
| FMDB1157 | 23806758 | NA | NA | VGSVF | VGSVF | 5 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 508.28 | NA |
| FMDB1158 | 23806758 | NA | NA | GGKDQRLP | GGKDQRLP | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 435.77+2 | NA | NA |
| FMDB1159 | 23806758 | NA | NA | LVGGASLKPEF | LVGGASLKPEF | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 559.33 | NA |
| FMDB1160 | 23806758 | NA | NA | KSLLGK | KSLLGK | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 323.22+2 | NA | NA |
| FMDB1161 | 23806758 | NA | NA | KSLLGKD | KSLLGKD | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 380.74+2 | NA | NA |
| FMDB1162 | 23806758 | NA | NA | KSLLGKDVL | KSLLGKDVL | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 486.82+2 | NA | NA |
| FMDB1163 | 23806758 | NA | NA | LEGKVLPGVDALS | LEGKVLPGVDALS | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 649.39+2 | NA | NA |
| FMDB1164 | 23806758 | NA | NA | PFGNTHNKYKLNF | PFGNTHNKYKLNF | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 527.28+3 | NA | NA |
| FMDB1165 | 23806758 | NA | NA | PGHPFIM | PGHPFIM | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 407.71+2 | NA | NA |
| FMDB1166 | 23806758 | NA | NA | IDDHFL | IDDHFL | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 380.2+2 | NA | NA |
| FMDB1167 | 23806758 | NA | NA | KPVSPLL | KPVSPLL | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 377.25+2 | NA | NA |
| FMDB1168 | 23806758 | NA | NA | TAAVGSVF | TAAVGSVF | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 751.42 | NA |
| FMDB1169 | 23806758 | NA | NA | YVTAIRNL | YVTAIRNL | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | NA | 475.292+ | NA |
| FMDB1170 | 23806758 | NA | NA | VILFH | VILFH | 5 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 314.7+2 | NA | NA |
| FMDB1171 | 23806758 | NA | NA | AAVYKALSDHHIYL | AAVYKALSDHHIYL | 14 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 534.3+3 | NA | NA |
| FMDB1172 | 23806758 | NA | NA | YKALSDHHIYL | YKALSDHHIYL | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 453.92+3 | NA | NA |
| FMDB1173 | 23806758 | NA | NA | VDTSKGFLID | VDTSKGFLID | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 547.8+2 | NA | NA |
| FMDB1174 | 23806758 | NA | NA | PILYRPVAVA | PILYRPVAVA | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 549.85+2 | NA | NA |
| FMDB1175 | 23806758 | NA | NA | QQAVRAIVSCFPN | QQAVRAIVSCFPN | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 478.26+3 | NA | NA |
| FMDB1176 | 23806758 | NA | NA | QLVMFVLQL | QLVMFVLQL | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. curvatus CRL705 | peptidases | nanoLC-ESI-QTOF | 545.83+2 | NA | NA |
| FMDB1177 | 23806758 | NA | NA | FISNHAY | FISNHAY | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 426.211+2 | NA | NA |
| FMDB1178 | 23806758 | NA | NA | AMQKIF oxidation (M) b | AMQKIF | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 377.2+2 | NA | NA |
| FMDB1179 | 23806758 | NA | NA | LKTAIQAAGYPDKVoxidation (M);deamidated (NQ)c | LKTAIQAAGYPDKV | 14 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 631.36+2 | NA | NA |
| FMDB1180 | 23806758 | NA | NA | IKNYPVVSIED | IKNYPVVSIED | 11 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 638.85+2 | NA | NA |
| FMDB1181 | 23806758 | NA | NA | AAVYKALSDHHIY | AAVYKALSDHHIY | 13 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 496.59+2 | NA | NA |
| FMDB1182 | 23806758 | NA | NA | SDHHIYL | SDHHIYL | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 442.72+2 | NA | NA |
| FMDB1183 | 23806758 | NA | NA | LSGGQSEEEASINL | LSGGQSEEEASINL | 14 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 717.35+2 | NA | NA |
| FMDB1184 | 23806758 | NA | NA | TFSYGRALQA | TFSYGRALQA | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 557.3+2 | NA | NA |
| FMDB1185 | 23806758 | NA | NA | FISNHAY | FISNHAY | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 426.211+2 | NA | NA |
| FMDB1186 | 23806758 | NA | NA | MVLPPP | MVLPPP | 6 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 669.43+1 | NA | NA |
| FMDB1187 | 23806758 | NA | NA | VGLDTTKF | VGLDTTKF | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 440.74+2 | NA | NA |
| FMDB1188 | 23806758 | NA | NA | VGGASLKPEF | VGGASLKPEF | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 502.78+ 2 | NA | NA |
| FMDB1189 | 23806758 | NA | NA | SPLPVIPH | SPLPVIPH | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 430.26+2 | NA | NA |
| FMDB1190 | 23806758 | NA | NA | MPQQIGVP | MPQQIGVP | 8 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 435.77+2 | NA | NA |
| FMDB1191 | 23806758 | NA | NA | KETPSGFTLD | KETPSGFTLD | 10 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 547.78+2 | NA | NA |
| FMDB1192 | 23806758 | NA | NA | VIQTGVD | VIQTGVD | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 731.4 +1 | NA | NA |
| FMDB1193 | 23806758 | NA | NA | YYKATEPVI | YYKATEPVI | 9 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 542.29+2 | NA | NA |
| FMDB1194 | 23806758 | NA | NA | PAKIEAF | PAKIEAF | 7 | Porcine sarcoplasmic proteins | NA | NA | 30c | 96h | Ace-inhibitory | In vitro | NA | fluorescence method for the assay of ACE using substrate o-aminobenzoylglycyl-p-nitro-L-phenylalanyl-L-proline | L. sakei CRL1862 | peptidases | nanoLC-ESI-QTOF | 388.23+ 2 | NA | NA |
| FMDB1290 | NA | li15 | Purification and identification of novel peptides with inhibitory effect against angiotensin I-converting enzyme and optimization of process conditions in Milk fermented with the yeast Kluyveromyces marxianus | VLSRYP | VLSRYP | 6 | Fermented Milk (reconstituted skim Milk) | k-Casein | 4.3 | 32c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay By HPLC | Kluyveromyces marxianus Z17 | proteinase and peptidase | MALDI/TOF-TOF MS/MS | NA | NA | 36.7 uM |
| FMDB1291 | NA | li15 | NA | LRFF | LRFF | 4 | Fermented Milk (reconstituted skim Milk) | αS1-Casein | 4.3 | 32c | 48h | Ace-inhibitory | In vitro | NA | Ace inhibitory assay By HPLC | Kluyveromyces marxianus Z17 | proteinase and peptidase | MALDI/TOF-TOF MS/MS | NA | NA | 116.9uM |
| FMDB1907 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1908 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1909 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1910 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1911 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1912 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1913 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1914 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1915 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1916 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1917 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1918 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1919 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1920 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1921 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1922 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of Wholemeal wheat Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1923 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1924 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1925 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1926 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1927 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1928 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1929 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1930 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1931 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1932 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1933 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1934 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1935 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1936 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1937 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE of soybean Flour dough | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1938 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1939 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1940 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1941 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1942 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1943 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1944 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1945 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1946 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1947 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1948 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1949 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1950 | 22098174 | NA | NA | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 43 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1951 | 22098174 | NA | NA | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | QHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 40 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1952 | 22098174 | NA | NA | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | KQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD | 32 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1953 | 22098174 | NA | NA | TPCEKHIMEKIQGRGDDDDDDDDD | TPCEKHIMEKIQGRGDDDDDDDDD | 24 | WSE barley Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1954 | 22098174 | NA | NA | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 59 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1955 | 22098174 | NA | NA | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 40 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus curvatus SAL33 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1956 | 22098174 | NA | NA | KMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | KMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 42 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1957 | 22098174 | NA | NA | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 40 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus rossiae CD76 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1958 | 22098174 | NA | NA | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 59 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1959 | 22098174 | NA | NA | KMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | KMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 42 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1960 | 22098174 | NA | NA | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 40 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus brevis AM7 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1961 | 22098174 | NA | NA | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 59 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1962 | 22098174 | NA | NA | KMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | KMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 42 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1963 | 22098174 | NA | NA | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 40 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus pentosus 12H6 | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1964 | 22098174 | NA | NA | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | SKWQHQQDSCRKQLQGFKMTATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 59 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1965 | 22098174 | NA | NA | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | TATPPCEKHITRAFRRAPIQQRGRGISTRRGDDDDDDDDD | 40 | WSE of amaranth Flour | NA | 4 | 30c | 16h | NA | NA | NA | NA | Lactobacillus plantarum 3DM | proteinase and peptidase | nano-LC-ESI-MS | NA | NA | NA |
| FMDB1972 | 19619856 | NA | NA | IPP | IPP | 3 | Casein miso paste (sodium Caseinate (24%: w/w), rice koji (20.9%: w/w), salt (10.8%: w/w), S.cerevisiae (0.1%: w/w) and water (3.1%: w/w) | Casein | NA | 30c | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | A.oryzae in rice koji +Saccharomyces cerevisiae | proteinase and peptidase | LC-MS | NA | NA | NA |
| FMDB1973 | 19619856 | NA | NA | VPP | VPP | 3 | Casein miso paste (sodium Caseinate (24%: w/w), rice koji (20.9%: w/w), salt (10.8%: w/w), S.cerevisiae (0.1%: w/w) and water (3.1%: w/w) | Casein | NA | 30c | 7days | Ace-inhibitory | In vitro | NA | Spectrophotometric assay using HHL as substate | A.oryzae in rice koji +Saccharomyces cerevisiae | proteinase and peptidase | LC-MS | NA | NA | NA |
| FMDB1974 | 19619856 | NA | NA | IPP | IPP | 3 | Casein miso paste (sodium Caseinate (24%: w/w), rice koji (20.9%: w/w), salt (10.8%: w/w), S.cerevisiae (0.1%: w/w) and water (3.1%: w/w) | Casein | NA | 30c | 7days | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | A.oryzae in rice koji +Saccharomyces cerevisiae | proteinase and peptidase | LC-MS | NA | NA | NA |
| FMDB1975 | 19619856 | NA | NA | VPP | VPP | 3 | Casein miso paste (sodium Caseinate (24%: w/w), rice koji (20.9%: w/w), salt (10.8%: w/w), S.cerevisiae (0.1%: w/w) and water (3.1%: w/w) | Casein | NA | 30c | 7days | Ace-inhibitory | In vivo | spontaneously Hypertensive Rats | NA | A.oryzae in rice koji +Saccharomyces cerevisiae | proteinase and peptidase | LC-MS | NA | NA | NA |
| FMDB2046 | 24175632;23742096 | NA | NA | pyro ENIDNP | pyro ENIDNP | 11 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis;colitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 683.4 | NA |
| FMDB2047 | 24175632;23742096 | NA | NA | pyroENI | pyroENI | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 357.1 | NA |
| FMDB2048 | 24175632;23742096 | NA | NA | pyroEV | pyroEV | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 229.1 | NA |
| FMDB2049 | 24175632;23742096 | NA | NA | pyroELW | pyroELW | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 428.9 | NA |
| FMDB2050 | 24175632;23742096 | NA | NA | pyroEVA | pyroEVA | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 299.9 | NA |
| FMDB2051 | 24175632;23742096 | NA | NA | pyroEVP | pyroEVP | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 325.9 | NA |
| FMDB2052 | 24175632;23742096 | NA | NA | pyroEVV | pyroEVV | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 328 | NA |
| FMDB2053 | 24175632;23742096 | NA | NA | pyroENF | pyroENF | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 390.9 | NA |
| FMDB2054 | 24175632;23742096 | NA | NA | pyroEL | pyroEL | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 243 | NA |
| FMDB2055 | 24175632;23742096 | NA | NA | pyroEQ | pyroEQ | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 258.1 | NA |
| FMDB2056 | 24175632;23742096 | NA | NA | pyroESQ | pyroESQ | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 345.1 | NA |
| FMDB2057 | 24175632;23742096 | NA | NA | pyroEM | pyroEM | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 260.9 | NA |
| FMDB2058 | 24175632;23742096 | NA | NA | pyroEGQ | pyroEGQ | 7 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 314.9 | NA |
| FMDB2059 | 24175632;23742096 | NA | NA | pyroEY | pyroEY | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 293 | NA |
| FMDB2060 | 24175632;23742096 | NA | NA | pyroEF | pyroEF | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 276.9 | NA |
| FMDB2061 | 24175632;23742096 | NA | NA | pyroEN | pyroEN | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 244.2 | NA |
| FMDB2062 | 24175632;23742096 | NA | NA | pyroES | pyroES | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 216.9 | NA |
| FMDB2063 | 24175632;23742096 | NA | NA | pyroEG | pyroEG | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 187.1 | NA |
| FMDB2064 | 24175632;23742096 | NA | NA | pyroGA | pyroGA | 6 | Japenese Rice wine Sake (steamed rice-koji-shubo-moromi) | NA | NA | 30C-22C-14C-10C | 48h-4days-2days-20days | Attenuate hepatitis | NA | NA | NA | A.oryzae and S. cerevisae | extracellular acid proteinases and acid carboxypeptidases | LC−MS/MS | NA | 200.9 | NA |
| FMDB2086 | 23871374 | NA | NA | RELEELNVPGEIVE | RELEELNVPGEIVE | 14 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 812.9163+2 | 1623.8181 | NA |
| FMDB2087 | 23871374 | NA | NA | LTDVENLHLPLP | LTDVENLHLPLP | 12 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 680.8648+2 | 1359.7151 | NA |
| FMDB2088 | 23871374 | NA | NA | DVENLHLPLP | DVENLHLPLP | 10 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 573.8003+2 | 1145.5861 | NA |
| FMDB2089 | 23871374 | NA | NA | LLQSWMHQPHQPLPPT | LLQSWMHQPHQPLPPT | 16 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 642.6568+3 | 1924.9486 | NA |
| FMDB2090 | 23871374;15030202 | NA | NA | VLSLSQSKVLPVPQK | VLSLSQSKVLPVPQK | 15 | Casein | β-Casein | 7 | 37c | 48h | Antioxidant | In vitro | NA | ABTS radical scavenging activity and total phenolic content measurement | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 541.6613+3 | 1621.9622 | NA |
| FMDB2091 | 23871374 | NA | NA | VLSLSQSKVLPVP | VLSLSQSKVLPVP | 13 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 683.9064+2 | 1365.7982 | NA |
| FMDB2092 | 23871374;15030202 | NA | NA | VLSLSQSKVLPVPQKAVPYPQRDMPIQA | VLSLSQSKVLPVPQKAVPYPQRDMPIQA | 28 | Casein | β-Casein | 7 | 37c | 48h | Antioxidant | In vitro | NA | ABTS radical scavenging activity and total phenolic content measurement | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 777.1820+4 | 3104.699 | NA |
| FMDB2093 | 23871374 | NA | NA | AVPYPQRDMPIQAF | AVPYPQRDMPIQAF | 14 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 816.8999+2 | 1631.7853 | NA |
| FMDB2094 | 23871374 | NA | NA | FLLYQEPVLGPVR | FLLYQEPVLGPVR | 13 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 765.9241+2 | 1529.8336 | NA |
| FMDB2095 | 23871374 | NA | NA | LLYQEPVLGPVRGPFPIIV | LLYQEPVLGPVRGPFPIIV | 19 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 703.0782+3 | 2106.2126 | NA |
| FMDB2096 | 23871374 | NA | NA | LLYQEPVLGPVRGPFP | LLYQEPVLGPVRGPFP | 16 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 891.485+2 | 1780.9554 | NA |
| FMDB2097 | 23871374 | NA | NA | LLYQEPVLGPVR | LLYQEPVLGPVR | 12 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 692.3918+2 | 1382.769 | NA |
| FMDB2098 | 23871374 | NA | NA | LYQEPVLGPVRGPFPIIV | LYQEPVLGPVRGPFPIIV | 18 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 997.5643+2 | 1993.114 | NA |
| FMDB2099 | 23871374 | NA | NA | YQEPVLGPVRGPFP | YQEPVLGPVRGPFP | 14 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 778.4065+2 | 1554.7985 | NA |
| FMDB2100 | 23871374 | NA | NA | YQEPVLGPVRGPFPIIV | YQEPVLGPVRGPFPIIV | 17 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 941.0173+2 | 1880.02 | NA |
| FMDB2101 | 23871374 | NA | NA | QEPVLGPVRGPFPIIV | QEPVLGPVRGPFPIIV | 16 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 859.4916+2 | 1716.9686 | NA |
| FMDB2102 | 23871374 | NA | NA | EPVLGPVRGPFPIIV | EPVLGPVRGPFPIIV | 15 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 795.4614+2 | 1588.9083 | NA |
| FMDB2103 | 23871374 | NA | NA | VLGPVRGPFPIIV | VLGPVRGPFPIIV | 13 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 682.4138+2 | 1362.8131 | NA |
| FMDB2104 | 23871374 | NA | NA | GPVRGPFPIIV | GPVRGPFPIIV | 11 | Casein | β-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 576.341+2 | 1150.6675 | NA |
| FMDB2105 | 23871374 | NA | NA | HQGLPQEVLNENLLRF | HQGLPQEVLNENLLRF | 16 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 636.3389+3 | 1905.995 | NA |
| FMDB2106 | 23871374 | NA | NA | HQGLPQEVLNENLLR | HQGLPQEVLNENLLR | 15 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 587.3146+3 | 1758.9219 | NA |
| FMDB2107 | 23871374 | NA | NA | GLPQEVLNENLLRF | GLPQEVLNENLLRF | 14 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 821.4382+2 | 1640.8618 | NA |
| FMDB2108 | 23871374 | NA | NA | GLPQEVLNENLLR | GLPQEVLNENLLR | 13 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 747.9074+2 | 1493.8003 | NA |
| FMDB2109 | 23871374 | NA | NA | LPQEVLNENLLRF | LPQEVLNENLLRF | 13 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 792.9267+2 | 1583.8389 | NA |
| FMDB2110 | 23871374 | NA | NA | LPQEVLNENLLR | LPQEVLNENLLR | 12 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 719.3941+2 | 1436.7737 | NA |
| FMDB2111 | 23871374 | NA | NA | PQEVLNENLLR | PQEVLNENLLR | 11 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 662.8528+2 | 1323.691 | NA |
| FMDB2112 | 23871374 | NA | NA | EVLNENLLRF | EVLNENLLRF | 10 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 623.8431+2 | 1245.6467 | NA |
| FMDB2113 | 23871374 | NA | NA | VLNENLLRF | VLNENLLRF | 9 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 559.3113+2 | 1116.608 | NA |
| FMDB2114 | 23871374 | NA | NA | FVAPFPEVFGKEK | FVAPFPEVFGKEK | 13 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 498.9325+3 | 1493.7756 | NA |
| FMDB2115 | 23871374 | NA | NA | FVAPFPEVFGKE | FVAPFPEVFGKE | 12 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 683.8444+2 | 1365.6743 | NA |
| FMDB2116 | 23871374 | NA | NA | FSDIPNPIGSENSEKTTMPLW | FSDIPNPIGSENSEKTTMPLW | 21 | Casein | αS1-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 793.7063+3 | 2378.0972 | NA |
| FMDB2117 | 23871374 | NA | NA | LNYYQQKPVALINNQ | LNYYQQKPVALINNQ | 15 | Casein | k-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 903.4642+2 | 1804.9138 | NA |
| FMDB2118 | 23871374 | NA | NA | FLPYPYYAKPAAVRSPAQ | FLPYPYYAKPAAVRSPAQ | 18 | Casein | k-Casein | 7 | 37c | 48h | NA | NA | NA | NA | Bifidobacterium longum KACC91563 | peptidase | LC-nano ESI-MS/MS | 680.3546+3 | 2038.042 | NA |