Browse result page of AntiTbPdb
The total number entries retrieved from this search are 547
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1124 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | MIC50 = 17 ± 9 mg/L | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1125 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 25618) | 6.25 mg/L causes 30% growth inhibition of M. tuberculosis H37Rv | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1126 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | 50 mg/L causes 39 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1127 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis E1380/94 MDR (Isoniazid, rifampicin, streptomycin, ethambutol) strain | MIC50 = 93 ± 12 mg/L | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1128 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis P34/95 MDR (isoniazid and rifampicin) strain | 50 mg/L causes 49 % growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1129 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis #894-D11 streptomycin resistant strain | 50 mg/L causes 80% growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1130 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium tuberculosis | BTB 98-492 drug suspectible swedish clinical isolate | 50 mg/L causes 80% growth inhibition | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1131 | PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Free | Amidation | None | Linear | 39 | L | Amphipathic | Natural | Isolated from porcine leucocytes | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC 19420) | IC90 = 50mg/L | In vitro | None | NA | NA | None | NA | NA | Disrupt the membrane architecture | Cell envelope | None | Antibacterial against salmonella, staphylococcus and neisseria | 2001 | 11328767 |
antitb_1136 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin, found in NK cells and cytotoxic T cells | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 17.5 μg of NK-2/ml killed >90% M. smegmatis population after 24 h of incubation | In vitro | RAW264.7 | No significant reduction in intracellular survival of M. smegmatis was observed | No significant reduction in cell viability upto 100 μg/ml | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | None | Antibacterial, Antiprotozoan (Trypanosoma cruzi and Plasmodium falciparum) and antifungal (Candida albicans) | 2013 | 23689720 |
antitb_1137 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin, found in NK cells and cytotoxic T cells | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 7 μg of NK- 2/ml combined with 0.5 ppm of NP-1 kills 90% of M. smegmatis | In vitro | RAW264.7 | Combination of NP-1 and NK-2 showed 35% reduction in intracellular survival of M. smegmatis | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a plant Alstonia macrophylla (NP-1). | Antibacterial, Antiprotozoan (Trypanosoma cruzi and Plasmodium falciparum) and antifungal (Candida albicans) | 2013 | 23689720 |
antitb_1138 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin, found in NK cells and cytotoxic T cells | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 7 μg of NK- 2/ml combined with 0.5 ppm of NP-2 kills 90% of M. smegmatis | In vitro | RAW264.7 | NP-2 in combination with NK-2 killed >52% intra- cellular M. smegmatis. | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a fungal Trichoderma sp. (NP-2). | Antibacterial, Antiprotozoan (Trypanosoma cruzi and Plasmodium falciparum) and antifungal (Candida albicans) | 2013 | 23689720 |
antitb_1139 | NK-2 | KILRGVCKKIMRTFLRRISKDILTGKK | Free | Amidation | None | Linear | 27 | L | Cationic | Protein Derived | Core region of the lymphocytic effector protein NK-lysin, found in NK cells and cytotoxic T cells | Mycobacterium marinum | Mycobacterium marinum (ATCC 927) | IC90 = 3.5 μg/ml | In vitro | RAW264.7 | Moderate killing was observed | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | None | Antibacterial, Antiprotozoan (Trypanosoma cruzi and Plasmodium falciparum) and antifungal (Candida albicans) | 2013 | 23689720 |
antitb_1140 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-37 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 25 μg of LLKKK-18/ml killed >80% of M. smegmatis after 24 h | In vitro | RAW264.7 | No significant reduction in intracellular survival of M. smegmatis was observed | No significant reduction in cell viability upto 25 μg/ml | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | None | None | 2013 | 23689720 |
antitb_1141 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-38 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 0.5 ppm of NP-1 combined with 1 μg/ml of LLKKK-18 kills 50% of M. smegmatis | In vitro | RAW264.7 | NP-1 in combination with LLKKK-18 kills 65% of mycobacteria compared to NP-1 or LLKKK-18 alone. | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a plant Alstonia macrophylla (NP-1). | None | 2013 | 23689720 |
antitb_1142 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-39 | Mycobacterium smegmatis | Mycobacterium smegmatis mc2155 (ATCC 700084) | 0.5 ppm of NP-2 combined with 1 μg/ml of LLKKK-18 kills 89% of M. smegmatis | In vitro | RAW264.7 | No significant reduction | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | AgNPs synthesiszed only in the presence of a fungal Trichoderma sp. (NP-2). | None | 2013 | 23689720 |
antitb_1143 | LLKKK-18 | KEFKRIVKRIKKFLRKL | Free | Free | None | Linear | 17 | L | Amphipathic | Protein Derived | Variant of LL-40 | Mycobacterium marinum | Mycobacterium marinum (ATCC 927) | IC 90 = 1 μg/ml | In vitro | RAW264.7 | Moderate killing was observed | No significant reduction in cell viability either treating alone or combination | None | NA | NA | Permeabilization of the bacterial cell membrane | Cell envelope | None | None | 2013 | 23689720 |
antitb_1164 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 15.8 ± 4.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1165 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 =34.6 ± 22.4 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1166 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC50 = 11.0 ± 4.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1167 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC90 = 65.8 ± 19.3 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1168 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC50 = 15.2 ± 2.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1169 | hLFcin1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Protein Derived | From human lactoferrin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC90 =37.9 ± 15.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1170 | hLFcin1-11 all K | GKKKKSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 39.1 ± 6.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
antitb_1171 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 14.2 ± 1.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1172 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 18.9 ± 4.0 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1173 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC50 = 8.0 ± 1.5 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1174 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth transparent variant (SmT) | IC90 = 22.8 ± 9.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1175 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC50 = 12.4 ± 0.3 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1176 | LFcin17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | From bovine lactoferricin | Mycobacterium avium | Mycobacterium avium strain 2-151 smooth doomed variant (SmD) | IC90 = 21.5 ± 4.0 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | Antibacterial | 2014 | 24709266 |
antitb_1177 | D-LFcin17-30 | fkcrrwqwrmkklg | Free | Free | None | Linear | 14 | D | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 10.7 ± 0.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
antitb_1178 | D-LFcin17-30 | fkcrrwqwrmkklg | Free | Free | None | Linear | 14 | D | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 14.4 ± 1.9 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
antitb_1179 | LFcin17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 18.0 ± 2.1 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
antitb_1180 | LFcin17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 34.4 ± 8.2 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
antitb_1181 | LFcin17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC50 = 10.8 ± 1.6 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
antitb_1182 | LFcin17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | NA | Mycobacterium avium | Mycobacterium avium strain 2447 smooth transparent variant (SmT) | IC90 = 19.3 ± 4.8 | In vitro | None | NA | NA | None | NA | NA | Permeabilization of peptide causes significant changes both in the surface and in the ultrastructural organization of the mycobacterial cells. | Cell envelope | None | None | 2014 | 24709266 |
antitb_1183 | SL3 | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW | Free | Free | None | Linear | 33 | L | NA | Natural | Isolated from lung cDNA library | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 45% reduction in growth was observed | Both | THP-1 cells | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection | No cytotoxicty | BALB/c female mice at 6–8 weeks of age | NA | NA | Disruption in mycobacterila secretory and cell wall biosynthetic pathway | Molecules specific to mycobacterial cell | None | None | 2014 | 25349777 |
antitb_1184 | H37Rv/SL3 | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW | Free | 6-histidine | None | Linear | 33 | L | NA | Natural | Expressing SL3-His6X endogenously | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | 45% reduction in growth was observed | Both | THP-1 cells | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection | No cytotoxicty | BALB/c female mice at 6–8 weeks of age | NA | NA | Disruption in mycobacterila secretory and cell wall biosynthetic pathway | Molecules specific to mycobacterial cell | Endogenously produced with in M.tb | None | 2014 | 25349777 |
antitb_1185 | Pin2 | FWGALAKGALKLIPSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Natural | Venom of the African scorpion Pandinus imperator | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 57.7 ± 22.3 μg/ml or 22.1 ± 8.6 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 3.3 [1.9–5.7]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
antitb_1186 | Pin2 | FWGALAKGALKLIPSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Natural | Venom of the African scorpion Pandinus imperator | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 86.5 μg/ml or 33.1 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 3.3 [1.9–5.7]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
antitb_1187 | Pin2 [G] | FWGALAKGALKLIGSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by G) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 48.1 μg/ml or 18.7 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 1.4 [0.4–4.3] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
antitb_1188 | Pin2 [G] | FWGALAKGALKLIGSLFSSFSKKD | Free | Free | None | Linear | 24 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by G) | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 48.1 μg/ml or 18.7 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 1.4 [0.4–4.3] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
antitb_1189 | Pin2 [GPG] | FWGALAKGALKLIGPGSLFSSFSKKD | Free | Free | None | Linear | 26 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by GPG) | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 80.1 ± 24.8 μg/ml or 29 ± 9 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 46.6 [34–64] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
antitb_1190 | Pin2 [GPG] | FWGALAKGALKLIGPGSLFSSFSKKD | Free | Free | None | Linear | 26 | L | Cationic | Synthetic | Amino acid substitution at one postion of Pin2 (P at 14 by GPG) | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 48.1 μg/ml or 17.4 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 46.6 [34–64] ) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
antitb_1191 | Pin2 [14] | FWGLKGLKKFSKKL | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | Short variant of Pin2 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 20 ± 6.92 μg/ml or 11.92 ± 3.7 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 418.4 [291–602]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
antitb_1192 | Pin2 [14] | FWGLKGLKKFSKKL | Free | Free | None | Linear | 14 | L | Cationic | Synthetic | Short variant of Pin3 | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 10 ± 3.1 μg/ml or 6 ± 1.8 μM | In vitro | RBC | NA | Hemolysis ( IC-50 = 418.4 [291–602]) | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
antitb_1193 | Pin2 [17] | FWGLKGLKGPGKFSKKL | Free | Free | None | Linear | 17 | L | Cationic | Synthetic | Short variant of Pin3 | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 22 ± 4.9 μg/ml or 11.65 ± 2.59 μM | In vitro | RBC | NA | No cytotoxicty, No Hemolysis | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
antitb_1194 | Pin2 [17] | FWGLKGLKGPGKFSKKL | Free | Free | None | Linear | 17 | L | Cationic | Synthetic | Short variant of Pin4 | Mycobacterium tuberculosis | Mycobacterium tuberculosis muti-drug resistant strain (MDR) clinical isolate | MIC = 28.0 ± 9.8 μg/ml or 14.85 ± 5.2 μM | In vitro | RBC | NA | No cytotoxicty, No Hemolysis | None | NA | NA | Cell wall disruption | Cell wall | None | Anti-bacterial (E. coli, S. aureus) | 2014 | 25019413 |
antitb_1219 | Cathelicidin HHC-10 | KRWWKWIRW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium tuberculosis complex bacteria, Mycobacterium bovis bacille calmette guerin (BCG) (Mycobacterium bovis BCG Pasteur 1173P2) | 69 % decrease in CFU at 50 μg/ ml | Both | None | NA | NA | 8–9 weeks old C57BL/6 mice | CFUs in mouse lungs were reduced 77.8% at 1.25 mg | Significant reduction of IFN-γ transcription | Cell envelope disruption | Cell envelope | None | Antibacterial (such as Pseudomonas aeruginosa, Escherichia coli, Klebsiella pneumonia, and S. aureus etc | 2013 | 23231581 |
antitb_1220 | Cathelicidin HHC-10 | KRWWKWIRW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium tuberculosis complex bacteria, Mycobacterium bovis bacille calmette guerin (BCG) (Mycobacterium bovis BCG Pasteur 1173P2) | 88 % decrease in CFU at 100 μg/ ml | Both | None | NA | NA | 8–9 weeks old C57BL/6 mice | CFUs in mouse lungs were reduced 95.8% at 2.5 mg k | Significant reduction of IFN-γ transcription | Cell envelope disruption | Cell envelope | None | Antibacterial (such as Pseudomonas aeruginosa, Escherichia coli, Klebsiella pneumonia, and S. aureus etc | 2013 | 23231581 |
antitb_1221 | PK34 | PRVIETKVHGREVTGLARNVSEENVDRLAKRWIK | Free | Free | None | Linear | 34 | L | Cationic | Synthetic | Searched and selected from mycobacteriophage genome sequences | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv strain (ATCC 27294 | MIC = 50 μg/ml | Both | Murine macrophage-like J774A.1 | NA | NA | Four-week-old female BALB/c mice | Dose of 20 mg (5×10−6 mol)/kg BW/d, PK34 had co | Inhibits the proinflammatory factor (IFN-γ, TNF-α, MCP-1, IL-6, IL-10, IL-12) production of macrophage cells induced by TDM. | Cell wall disruption | trehalose-6,6=-dimycolate (TDM) | None | None | 2013 | 23603838 |