| Primary information |
|---|
| ID | antitb_1183 |
| Peptide Name | SL3 |
| Sequence | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 33 |
| Chirality | L |
| Nature | NA |
| Source | Natural |
| Origin | Isolated from lung cDNA library |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis H37Rv |
| Inhibition Concentartion | 45% reduction in growth was observed |
| In vitro/In vivo | Both |
| Cell Line | THP-1 cells |
| Inhibition Concentartion | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection |
| Cytotoxicity | No cytotoxicty |
| In vivo Model | BALB/c female mice at 6–8 weeks of age |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | Disruption in mycobacterila secretory and cell wall biosynthetic pathway |
| Target | Molecules specific to mycobacterial cell |
| Combination Therapy | None |
| Other Activities | None |
| Pubmed ID | 25349777 |
| Year of Publication | 2014 |
| 3-D Structure |  View in Jmol or Download Structure |