Primary information |
---|
ID | antitb_1183 |
Peptide Name | SL3 |
Sequence | AAARIRHEGVFLLIGNSCFSLPRNGPQLLLLAW |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Length | 33 |
Chirality | L |
Nature | NA |
Source | Natural |
Origin | Isolated from lung cDNA library |
Species | Mycobacterium tuberculosis |
Strain | Mycobacterium tuberculosis H37Rv |
Inhibition Concentartion | 45% reduction in growth was observed |
In vitro/In vivo | Both |
Cell Line | THP-1 cells |
Inhibition Concentartion | Drastic reduction (~80%) in M.tb intracellular survival after 72 hrs of infection |
Cytotoxicity | No cytotoxicty |
In vivo Model | BALB/c female mice at 6–8 weeks of age |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | Disruption in mycobacterila secretory and cell wall biosynthetic pathway |
Target | Molecules specific to mycobacterial cell |
Combination Therapy | None |
Other Activities | None |
Pubmed ID | 25349777 |
Year of Publication | 2014 |
3-D Structure | View in Jmol or Download Structure |