Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| RID_0001 | 6-O-stearoyl-MDP (L18- MDP) Click for more detail | MDP (others) | CCCCCCCCCCCCCCCCCC(=O)NCCCCC(C(=O)O)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Synthetic | It leads to the induction of interferon in the lung. | Nod-like receptor 2 (NOD2) | NOD-like receptor (NLR) | Lungs | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | It augments host-resistance to viral infection. | Interferon assay | 2417426 | 1985 | Pubchem Assay | |
| RID_0001 | 6-O-stearoyl-MDP (L18- MDP) Click for more detail | MDP (others) | CCCCCCCCCCCCCCCCCC(=O)NCCCCC(C(=O)O)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Synthetic | It leads to the induction of interferon in the lung. | Nod-like receptor 2 (NOD2) | NOD-like receptor (NLR) | Lungs | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | It augments host-resistance to viral infection. | Interferon assay | 2417426 | 1985 | Pubchem Assay | |
| PRRID_0002 | N-acetylmuramyl-L-alanyl-D-isoglutamine (MDP) Click for more detail | NA | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Synthetic | It leads to the induction of interferon in the lung. | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Sendai virus infected mice | Lungs | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | It augments host-resistance to viral infection. | Interferon assay | 2417426 | 1985 | Pubchem Assay |
| PRRID_0002 | N-acetylmuramyl-L-alanyl-D-isoglutamine (MDP) Click for more detail | NA | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Synthetic | It leads to the induction of interferon in the lung. | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Sendai virus infected mice | Lungs | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | It augments host-resistance to viral infection. | Interferon assay | 2417426 | 1985 | Pubchem Assay |
| PRRID_0003 | N(alpha)-acetylmuramyl-L-alanyl-D-isoglutaminyl-N(epsilon)-stearoyl'L'lysine (MDP-L ys-L18) Click for more detail | MDP (others) | CCCCCCCCCCCCCCCCCC(=O)NCCCCC(C(=O)O)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Synthetic | It leads to the induction of interferon in the lung. | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Sendai virus infected mice | Lungs | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | It augments host-resistance to viral infection. | Interferon assay | 2417426 | 1985 | Pubchem Assay |
| PRRID_0003 | N(alpha)-acetylmuramyl-L-alanyl-D-isoglutaminyl-N(epsilon)-stearoyl'L'lysine (MDP-L ys-L18) Click for more detail | MDP (others) | CCCCCCCCCCCCCCCCCC(=O)NCCCCC(C(=O)O)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Synthetic | It leads to the induction of interferon in the lung. | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Sendai virus infected mice | Lungs | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | It augments host-resistance to viral infection. | Interferon assay | 2417426 | 1985 | Pubchem Assay |
| PRRID_0042 | poly D-glutamic acid Click for more detail | synthetic polypeptyide (others) | C(CC(=O)O)C(C(=O)O)N | NA | Peptide | Natural | Immunostimulant | Scavenger receptor C-1 (SR-C1) | Scavenger receptor (SR) | Drosophila melanogaster | NA | two complement control protein (CCP) domains and somatomedin B, MAM, and mucin-like domains | NA | NA | NA | NA | NA | 7732030 | 1995 | NA |
| PRRID_0042 | poly D-glutamic acid Click for more detail | synthetic polypeptyide (others) | C(CC(=O)O)C(C(=O)O)N | NA | Peptide | Natural | Immunostimulant | Scavenger receptor C-1 (SR-C1) | Scavenger receptor (SR) | Drosophila melanogaster | NA | two complement control protein (CCP) domains and somatomedin B, MAM, and mucin-like domains | NA | NA | NA | NA | NA | 7732030 | 1995 | NA |
| PRRID_0046 | amyloid beta peptide Click for more detail | Endogenous (others) | MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN | 770 | Peptide | Natural | Immunostimulant | Scavenger receptor A I (SR-A I) | Scavenger receptor (SR) | NA | NA | NA | NA | NA | NA | NA | ELISA | 8816718 | 1996 | NA |
| PRRID_0046 | amyloid beta peptide Click for more detail | Endogenous (others) | MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN | 770 | Peptide | Natural | Immunostimulant | Scavenger receptor A I (SR-A I) | Scavenger receptor (SR) | NA | NA | NA | NA | NA | NA | NA | ELISA | 8816718 | 1996 | NA |
| PRRID_0047 | amyloid beta peptide Click for more detail | Endogenous (others) | MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN | 770 | Peptide | Natural | Immunostimulant | Scavenger receptor A I (SR-A I) | Scavenger receptor (SR) | NA | NA | NA | NA | NA | NA | NA | ELISA | 8816718 | 1996 | NA |
| PRRID_0047 | amyloid beta peptide Click for more detail | Endogenous (others) | MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN | 770 | Peptide | Natural | Immunostimulant | Scavenger receptor A I (SR-A I) | Scavenger receptor (SR) | NA | NA | NA | NA | NA | NA | NA | ELISA | 8816718 | 1996 | NA |
| PRRID_0115 | beta-defensin Click for more detail | Endogenous (others) | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS | 69 | Peptide | Natural | Immunostimulant | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | NA | NA | 12411706 | 2002 | NA |
| PRRID_0115 | beta-defensin Click for more detail | Endogenous (others) | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS | 69 | Peptide | Natural | Immunostimulant | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | NA | NA | NA | NA | NA | NA | NA | NA | 12411706 | 2002 | NA |
| PRRID_0163 | C12-iE-DAP Click for more detail | Chemical derivative of iE-DAP(others) | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Peptide | Synthetic | elicit innate immune response | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Mice (Murine) | Macrophages | NA | Q8BHB0.fasta | Q8BHB0 | 953 | mediates selective recognition of bacteria through detection of iE-DAP-containing peptidoglycan. | ELISA | 12796777 | 2003 | Pubchem Assay |
| PRRID_0163 | C12-iE-DAP Click for more detail | Chemical derivative of iE-DAP(others) | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Peptide | Synthetic | elicit innate immune response | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Mice (Murine) | Macrophages | NA | Q8BHB0.fasta | Q8BHB0 | 953 | mediates selective recognition of bacteria through detection of iE-DAP-containing peptidoglycan. | ELISA | 12796777 | 2003 | Pubchem Assay |
| PRRID_0173 | iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail | Bacteria | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Peptide | Natural | elicit innate immune response | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Mice (Murine) | Macrophages | NA | Q8BHB0.fasta | Q8BHB0 | 953 | mediates selective recognition of bacteria through detection of iE-DAP-containing peptidoglycan. | ELISA | 12796777 | 2003 | Pubchem Assay |
| PRRID_0173 | iE-DAP (gamma-D-glutamyl-meso diaminopimelic acid) Click for more detail | Bacteria | N[C@@H](CCC[C@@H](NC(=O)CC[C@@H](N)C(O)=O)C(O)=O)C(O)=O | NA | Peptide | Natural | elicit innate immune response | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Mice (Murine) | Macrophages | NA | Q8BHB0.fasta | Q8BHB0 | 953 | mediates selective recognition of bacteria through detection of iE-DAP-containing peptidoglycan. | ELISA | 12796777 | 2003 | Pubchem Assay |
| PRRID_0178 | M-Tri-DAP (MurNAc-L-Ala-D-g-Glu-mDAP) Click for more detail | Gram-negative bacteria | NA | NA | Peptide | Natural | activation of the NF-κB pro-inflammatory cascade | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Macrophages | NA | Q9Y239.fasta | Q9Y239 | 953 | production of pro-inflammatory cytokines | NA | 12527755 | 2003 | Pubchem Assay |
| PRRID_0178 | M-Tri-DAP (MurNAc-L-Ala-D-g-Glu-mDAP) Click for more detail | Gram-negative bacteria | NA | NA | Peptide | Natural | activation of the NF-κB pro-inflammatory cascade | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Macrophages | NA | Q9Y239.fasta | Q9Y239 | 953 | production of pro-inflammatory cytokines | NA | 12527755 | 2003 | Pubchem Assay |
| PRRID_0180 | muramyl tripeptide Click for more detail | muramyl dipeptide derivative (others) | CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Synthetic | activation of the NF-κB pro-inflammatory cascade | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Macrophages | NA | Q9Y239.fasta | Q9Y239 | 953 | production of pro-inflammatory cytokines | NA | 12527755 | 2003 | Pubchem Assay |
| PRRID_0180 | muramyl tripeptide Click for more detail | muramyl dipeptide derivative (others) | CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Synthetic | activation of the NF-κB pro-inflammatory cascade | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Macrophages | NA | Q9Y239.fasta | Q9Y239 | 953 | production of pro-inflammatory cytokines | NA | 12527755 | 2003 | Pubchem Assay |
| PRRID_0188 | Tri-DAP (L-Ala-D-g-Glu-mDAP) Click for more detail | Bacteria | CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N | NA | Peptide | Natural | activation of the NF-κB pro-inflammatory cascade | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Macrophages | NA | Q9Y239.fasta | Q9Y239 | 953 | Phagocytosis of pathogens, Antigen presentation, Intracellular signalling, Resolution of inflammation | NA | 12527755 | 2003 | Pubchem Assay |
| PRRID_0188 | Tri-DAP (L-Ala-D-g-Glu-mDAP) Click for more detail | Bacteria | CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N | NA | Peptide | Natural | activation of the NF-κB pro-inflammatory cascade | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Macrophages | NA | Q9Y239.fasta | Q9Y239 | 953 | Phagocytosis of pathogens, Antigen presentation, Intracellular signalling, Resolution of inflammation | NA | 12527755 | 2003 | Pubchem Assay |
| PRRID_0220 | FK156 Click for more detail | NA | CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)NCC(=O)O)C(=O)O)NC(=O)C(C)O | NA | Peptide | Synthetic | It induces the secretion of the IL-8 | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Monocytes | NA | Q9Y239.fasta | Q9Y239 | 953 | It leads to the maturation and activation of the host cells. | ELISA | 15617523 | 2005 | Pubchem Assay |
| PRRID_0220 | FK156 Click for more detail | NA | CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)NCC(=O)O)C(=O)O)NC(=O)C(C)O | NA | Peptide | Synthetic | It induces the secretion of the IL-8 | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Monocytes | NA | Q9Y239.fasta | Q9Y239 | 953 | It leads to the maturation and activation of the host cells. | ELISA | 15617523 | 2005 | Pubchem Assay |
| PRRID_0221 | FK565 Click for more detail | NA | CC(C)(C)OC(=O)CCC(C(=O)O)NC(=O)OC(C)(C)C | NA | Peptide | Synthetic | It induces the secretion of the IL-8 | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Monocytes | NA | Q9Y239.fasta | Q9Y239 | 953 | It leads to the maturation and activation of the host cells. | ELISA | 15617523 | 2005 | Pubchem Assay |
| PRRID_0221 | FK565 Click for more detail | NA | CC(C)(C)OC(=O)CCC(C(=O)O)NC(=O)OC(C)(C)C | NA | Peptide | Synthetic | It induces the secretion of the IL-8 | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | Monocytes | NA | Q9Y239.fasta | Q9Y239 | 953 | It leads to the maturation and activation of the host cells. | ELISA | 15617523 | 2005 | Pubchem Assay |
| PRRID_0225 | muramyl tetrapeptide Click for more detail | muramyl dipeptide derivative (others) | NA | NA | Peptide | Synthetic | Immunostimulant | Nucleotide-binding oligomerization domain protein 1 | NOD-like receptor (NLR) | Mice (Murine) | NA | NA | Q8BHB0.fasta | Q8BHB0 | 953 | NA | ELISA | 16211083 | 2005 | Pubchem Assay |
| PRRID_0225 | muramyl tetrapeptide Click for more detail | muramyl dipeptide derivative (others) | NA | NA | Peptide | Synthetic | Immunostimulant | Nucleotide-binding oligomerization domain protein 1 | NOD-like receptor (NLR) | Mice (Murine) | NA | NA | Q8BHB0.fasta | Q8BHB0 | 953 | NA | ELISA | 16211083 | 2005 | Pubchem Assay |
| PRRID_0414 | AtPep1 Click for more detail | Arabidopsis thaliana(plant) | ATKVKAKQRGKEKVSSGRPGQHN | 23 | Peptide | Natural | It triggers a receptor-dependent transient depolarization through activation of plasma membrane anion channels. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0414 | AtPep1 Click for more detail | Arabidopsis thaliana(plant) | ATKVKAKQRGKEKVSSGRPGQHN | 23 | Peptide | Natural | It triggers a receptor-dependent transient depolarization through activation of plasma membrane anion channels. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0415 | AtPep2 Click for more detail | NA | DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED | 36 | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0415 | AtPep2 Click for more detail | NA | DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED | 36 | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0416 | AtPep3 Click for more detail | NA | EIKARGKNKTKPTPSSGKGGKHN | 23 | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0416 | AtPep3 Click for more detail | NA | EIKARGKNKTKPTPSSGKGGKHN | 23 | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0417 | AtPep4 Click for more detail | NA | NA | NA | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0417 | AtPep4 Click for more detail | NA | NA | NA | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0418 | AtPep5 Click for more detail | NA | NA | NA | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0418 | AtPep5 Click for more detail | NA | NA | NA | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0419 | AtPep6 Click for more detail | NA | NA | NA | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0419 | AtPep6 Click for more detail | NA | NA | NA | Peptide | Synthetic | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. | PEPR1 | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | NA | NA | NA | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | NA |
| PRRID_0494 | elf18 Click for more detail | NA | NA | NA | Peptide | Natural | It bind to the FLS2 and incites the downstream cascade. | EFR | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | C0LGT6.fasta | C0LGT6 | 1031 | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | Pubchem Assay |
| PRRID_0494 | elf18 Click for more detail | NA | NA | NA | Peptide | Natural | It bind to the FLS2 and incites the downstream cascade. | EFR | Toll-like receptor (TLR) | Arabidopsis | Plasma membrane | LRR | C0LGT6.fasta | C0LGT6 | 1031 | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | Pubchem Assay |
| PRRID_0523 | flg22 Click for more detail | Bacteria | QRLSTGSRINSAKDDAAGLQIA | 22 | Peptide | Natural | It bind to the FLS2 and incites the downstream cascade. | FLS2 | Pattern recognition receptor (PRR) | Arabidopsis | Plasma membrane | LRR | Q9FL28.fasta | Q9FL28 | 1173 | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | Pubchem Assay |
| PRRID_0523 | flg22 Click for more detail | Bacteria | QRLSTGSRINSAKDDAAGLQIA | 22 | Peptide | Natural | It bind to the FLS2 and incites the downstream cascade. | FLS2 | Pattern recognition receptor (PRR) | Arabidopsis | Plasma membrane | LRR | Q9FL28.fasta | Q9FL28 | 1173 | It caused seedling growth inhibition of arabidopsis thaliana | Growth inhibition assay | 20200150 | 2010 | Pubchem Assay |
| PRRID_0524 | fMLF Click for more detail | NA | NA | NA | Peptide | Synthetic | It activates the PMN in circukation and promote the Ca2+ flux and phosphorylation of MAP kinases | Formyl peptide receptor 1 | Pattern recognition receptor (PRR) | Human | Neutrophils | NA | P21462.fasta | P21462 | 350 | It incites non-specific organ attack and suppresses chemotactic responsess to infective stimuli. | Chemotaxis assay | 20203610 | 2010 | Pubchem Assay |
| PRRID_0524 | fMLF Click for more detail | NA | NA | NA | Peptide | Synthetic | It activates the PMN in circukation and promote the Ca2+ flux and phosphorylation of MAP kinases | Formyl peptide receptor 1 | Pattern recognition receptor (PRR) | Human | Neutrophils | NA | P21462.fasta | P21462 | 350 | It incites non-specific organ attack and suppresses chemotactic responsess to infective stimuli. | Chemotaxis assay | 20203610 | 2010 | Pubchem Assay |
| PRRID_0679 | mesodiaminopimelic acid Click for more detail | Bacteria | C(CC(C(=O)O)N)CC(C(=O)O)N | NA | Peptide | Natural | upon ligand sensing, oligomerize and recruit RIP2 via CARD-CARD interactions | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | It culminates in the activation of the NF-kB transcription factor, which drives proinflammatory gene regulation | NA | 20303873 | 2010 | NA |
| PRRID_0679 | mesodiaminopimelic acid Click for more detail | Bacteria | C(CC(C(=O)O)N)CC(C(=O)O)N | NA | Peptide | Natural | upon ligand sensing, oligomerize and recruit RIP2 via CARD-CARD interactions | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | It culminates in the activation of the NF-kB transcription factor, which drives proinflammatory gene regulation | NA | 20303873 | 2010 | NA |
| PRRID_0692 | muramyl dipeptide (MDP) Click for more detail | Streptococcus pneumoniae, Mycobacterium tuberculosis, and Listeria monocytogenes (Bacteria) | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | Activates NF-KB which results in the processing and release of the proinfl ammatory cytokines IL-1β, which results into pathogen clearance and sepsis resistance | cluster of differentiation 14 (CD14) | Pattern recognition receptor (PRR) | Human | NA | NA | Q9HC29.fasta | Q9HC29 | 1040 | It results into pathogen clearance and sepsis resistance | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0692 | muramyl dipeptide (MDP) Click for more detail | Streptococcus pneumoniae, Mycobacterium tuberculosis, and Listeria monocytogenes (Bacteria) | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | Activates NF-KB which results in the processing and release of the proinfl ammatory cytokines IL-1β, which results into pathogen clearance and sepsis resistance | cluster of differentiation 14 (CD14) | Pattern recognition receptor (PRR) | Human | NA | NA | Q9HC29.fasta | Q9HC29 | 1040 | It results into pathogen clearance and sepsis resistance | NA | 20740341 | 2010 | Pubchem Assay |
| PRRID_0693 | muramyl dipeptide (MDP) Click for more detail | Bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | upon ligand sensing, oligomerize and recruit RIP2 via CARD-CARD interactions | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | It culminates in the activation of the NF-kB transcription factor, which drives proinflammatory gene regulation | NA | 20303873 | 2010 | NA |
| PRRID_0693 | muramyl dipeptide (MDP) Click for more detail | Bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | upon ligand sensing, oligomerize and recruit RIP2 via CARD-CARD interactions | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | NA | NA | NA | NA | NA | NA | It culminates in the activation of the NF-kB transcription factor, which drives proinflammatory gene regulation | NA | 20303873 | 2010 | NA |
| PRRID_0694 | muramyl dipeptide (MDP) + LPS + Poly(I:C) Click for more detail | Bacteria | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Peptide | Natural | It help in NF | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | C57BL/6 Mice | liver and Hepatocytes | NA | Q3UP24.fasta | Q3UP24 | 1024 | It plays an important regulatory role in many inflammatory processes involving the liver. | Immunoblotting and EMSA | 20615568 | 2010 | Pubchem Assay |
| PRRID_0694 | muramyl dipeptide (MDP) + LPS + Poly(I:C) Click for more detail | Bacteria | C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O | NA | Peptide | Natural | It help in NF | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | C57BL/6 Mice | liver and Hepatocytes | NA | Q3UP24.fasta | Q3UP24 | 1024 | It plays an important regulatory role in many inflammatory processes involving the liver. | Immunoblotting and EMSA | 20615568 | 2010 | Pubchem Assay |
| PRRID_0871 | beta-defensin Click for more detail | Endogenous (others) | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS | 69 | Peptide | Natural | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Myeloid cells, microglia, astrocytes, neurons | NA | O00206.fasta | O00206 | 839 | plays a fundamental role in pathogen recognition and activation of innate immunity | NA | 21982558 | 2011 | Pubchem Assay |
| PRRID_0871 | beta-defensin Click for more detail | Endogenous (others) | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS | 69 | Peptide | Natural | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Myeloid cells, microglia, astrocytes, neurons | NA | O00206.fasta | O00206 | 839 | plays a fundamental role in pathogen recognition and activation of innate immunity | NA | 21982558 | 2011 | Pubchem Assay |
| PRRID_0935 | MDP (muramyldipeptide) Click for more detail | Gram-negative and Gram-positive bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | leads to cytokine activation, especially IL-1α and IL-1β. | Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3) | NOD-like receptor (NLR) | Human | Eosinophils | NA | Q96P20.fasta | Q96P20 | 1036 | recognizes fragments of the bacterial cell wall | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0935 | MDP (muramyldipeptide) Click for more detail | Gram-negative and Gram-positive bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | leads to cytokine activation, especially IL-1α and IL-1β. | Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing3 (Nalp3) | NOD-like receptor (NLR) | Human | Eosinophils | NA | Q96P20.fasta | Q96P20 | 1036 | recognizes fragments of the bacterial cell wall | real-time reverse transcription-PCR, FACS, ELISA | 21978001 | 2011 | Pubchem Assay |
| PRRID_0987 | Defensins Click for more detail | NA | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS | 69 | Peptide | Natural | Immunostimulant | Unknown | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | Antagonists and antibodies | NA | 22982943 | 2012 | NA |
| PRRID_0987 | Defensins Click for more detail | NA | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS | 69 | Peptide | Natural | Immunostimulant | Unknown | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | Antagonists and antibodies | NA | 22982943 | 2012 | NA |
| PRRID_1110 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | graft-versus-host disease (GVHD) | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1110 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | graft-versus-host disease (GVHD) | NA | Q8K3Z0.fasta | Q8K3Z0 | 1020 | NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1130 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses | Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R) | NOD-like receptor (NLR) | Human | graft-versus-host disease (GVHD) | NA | Q96P20.fasta | Q96P20 | 1036 | NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1130 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | a component of bacterial peptidoglycan, and induces NF-jB activation, leading to enhanced Th1 responses | Nod-like receptor protein 3 (P2X7R) (NLRP3 (P2X7R) | NOD-like receptor (NLR) | Human | graft-versus-host disease (GVHD) | NA | Q96P20.fasta | Q96P20 | 1036 | NOD2 functions as a primary sensor of microbial products inducing inflammatory T-cell responses and also negatively regulates TLR-mediated responses | NA | 23985302 | 2013 | Pubchem_assay |
| PRRID_1137 | Serum amyloid Click for more detail | Gram-positive bacteria | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY | 122 | Peptide | Natural | Play an important role in infectious inflammatory responses. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | NA | NA | NA | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | NA |
| PRRID_1137 | Serum amyloid Click for more detail | Gram-positive bacteria | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY | 122 | Peptide | Natural | Play an important role in infectious inflammatory responses. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | NA | NA | NA | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | NA |
| PRRID_1153 | SNApin A Click for more detail | Endogenous (others) | MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK | 136 | Peptide | Natural | Play an important role in infectious inflammatory responses. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | NA | NA | NA | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | NA |
| PRRID_1153 | SNApin A Click for more detail | Endogenous (others) | MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK | 136 | Peptide | Natural | Play an important role in infectious inflammatory responses. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | monocyte/macrophages, DCs, B-lymphocytes | extracellular domains of leucine-rich repeat motifs | NA | NA | NA | significant role in the pathogenesis of severe inflammatory responses | NA | 23985302 | 2013 | NA |
| PRRID_1189 | beta-defensin Click for more detail | Host (Endogenous) (others) | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS | 69 | Peptide | Natural | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses | JNKBP1 | Pattern recognition receptor (PRR) | TLR-deficient Mice on a C57BL/6 | monocyte/macrophages | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | ELISA | 24801735 | 2014 | Pubchem_assay |
| PRRID_1189 | beta-defensin Click for more detail | Host (Endogenous) (others) | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS | 69 | Peptide | Natural | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses | JNKBP1 | Pattern recognition receptor (PRR) | TLR-deficient Mice on a C57BL/6 | monocyte/macrophages | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | ELISA | 24801735 | 2014 | Pubchem_assay |
| PRRID_1229 | Defensins Click for more detail | Host (Endogenous) (others) | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS | 69 | Peptide | Natural | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Keratinocytes and mouse skin | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | play a role in UVB induced immune suppression | NA | 24786223 | 2014 | Pubchem_assay |
| PRRID_1229 | Defensins Click for more detail | Host (Endogenous) (others) | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS | 69 | Peptide | Natural | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Keratinocytes and mouse skin | cell surface | Q9QUK6.fasta | Q9QUK6 | 835 | play a role in UVB induced immune suppression | NA | 24786223 | 2014 | Pubchem_assay |
| PRRID_1230 | Defensins Click for more detail | Host (Endogenous) (others) | MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | 68 | Peptide | Natural | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Keratinocytes and mouse skin | cell surface | O00206.fasta | O00206 | 839 | play a role in UVB induced immune suppression | NA | 24786223 | 2014 | Pubchem_assay |
| PRRID_1230 | Defensins Click for more detail | Host (Endogenous) (others) | MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | 68 | Peptide | Natural | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Keratinocytes and mouse skin | cell surface | O00206.fasta | O00206 | 839 | play a role in UVB induced immune suppression | NA | 24786223 | 2014 | Pubchem_assay |
| PRRID_1386 | L-ornithine muramyl tripeptide Click for more detail | Gram-positive bacteria and some Gram-negative spirochaetes. | CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q8K3Z0.fasta | Q8K3Z0 | 1020 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1386 | L-ornithine muramyl tripeptide Click for more detail | Gram-positive bacteria and some Gram-negative spirochaetes. | CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q8K3Z0.fasta | Q8K3Z0 | 1020 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1387 | L-ornithine muramyl tripeptide Click for more detail | Gram-positive bacteria and some Gram-negative spirochaetes. | CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1387 | L-ornithine muramyl tripeptide Click for more detail | Gram-positive bacteria and some Gram-negative spirochaetes. | CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | Nod2, are associ- ated with inflammatory bowel disease in humans | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1483 | meso-diaminopomelic acid (meso- DAP) Click for more detail | Gram-negative bacteria and several Gram-positive bacteria such as Listeria and Bacillus spp | C(CC(C(=O)O)N)CC(C(=O)O)N | NA | Peptide | Natural | in vitro activates Nod1 | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | macrophages and mesothelial cells | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q9Y239.fasta | Q9Y239 | 953 | Nod1 ligation also leads to the activation of NF-jB and MAPKs in neutrophils | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1483 | meso-diaminopomelic acid (meso- DAP) Click for more detail | Gram-negative bacteria and several Gram-positive bacteria such as Listeria and Bacillus spp | C(CC(C(=O)O)N)CC(C(=O)O)N | NA | Peptide | Natural | in vitro activates Nod1 | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | macrophages and mesothelial cells | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q9Y239.fasta | Q9Y239 | 953 | Nod1 ligation also leads to the activation of NF-jB and MAPKs in neutrophils | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1484 | meso-lanthionine tripeptide Click for more detail | PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria) | NA | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Mice | most adult tissues | intracellular receptors | Q8BHB0.fasta | Q8BHB0 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1484 | meso-lanthionine tripeptide Click for more detail | PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria) | NA | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Mice | most adult tissues | intracellular receptors | Q8BHB0.fasta | Q8BHB0 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1485 | meso-lanthionine tripeptide Click for more detail | PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria) | NA | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | most adult tissues | intracellular receptors | Q9Y239.fasta | Q9Y239 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1485 | meso-lanthionine tripeptide Click for more detail | PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria) | NA | NA | Peptide | Natural | in vitro activates Nod | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | most adult tissues | intracellular receptors | Q9Y239.fasta | Q9Y239 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1491 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | leads to cytokine activation, especially IL-1α and IL-1β. | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | peripheral blood mononuclear cells such as macrophages, granulocytes, dendritic cells, and along the intestinal epithelial cells | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | recognizes fragments of the bacterial cell wall. | Luciferase assay | 24790089 | 2014 | Pubchem_assay |
| PRRID_1491 | muramyl dipeptide (MDP) Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | leads to cytokine activation, especially IL-1α and IL-1β. | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | peripheral blood mononuclear cells such as macrophages, granulocytes, dendritic cells, and along the intestinal epithelial cells | intracellular receptors | Q9HC29.fasta | Q9HC29 | 1040 | recognizes fragments of the bacterial cell wall. | Luciferase assay | 24790089 | 2014 | Pubchem_assay |
| PRRID_1493 | muramyl dipeptide (MDP) Click for more detail | Gram-negative and Gram-positive bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | Neutrophils | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q8K3Z0.fasta | Q8K3Z0 | 1020 | involved in neutrophil immune responses in response to bacterial infection. | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1493 | muramyl dipeptide (MDP) Click for more detail | Gram-negative and Gram-positive bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Mice | Neutrophils | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q8K3Z0.fasta | Q8K3Z0 | 1020 | involved in neutrophil immune responses in response to bacterial infection. | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1494 | muramyl dipeptide (MDP) Click for more detail | Gram-negative and Gram-positive bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | Neutrophils | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q8K3Z0.fasta | Q8K3Z0 | 1020 | involved in neutrophil immune responses in response to bacterial infection. | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1494 | muramyl dipeptide (MDP) Click for more detail | Gram-negative and Gram-positive bacteria | CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C | NA | Peptide | Natural | induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | Neutrophils | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q8K3Z0.fasta | Q8K3Z0 | 1020 | involved in neutrophil immune responses in response to bacterial infection. | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1495 | muramyl tripeptide Click for more detail | Mycobacteria (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Mice | intraepithelial T lymphocytes | intracellular receptors | Q9JLF7.fasta | Q9JLF7 | 859 | recognises peptidoglycan of bacterial cell wall | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1495 | muramyl tripeptide Click for more detail | Mycobacteria (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Mice | intraepithelial T lymphocytes | intracellular receptors | Q9JLF7.fasta | Q9JLF7 | 859 | recognises peptidoglycan of bacterial cell wall | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1496 | muramyl tripeptide Click for more detail | Mycobacteria (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Human | intraepithelial T lymphocytes | intracellular receptors | Q96PD5.fasta | Q96PD5 | 576 | recognises peptidoglycan of bacterial cell wall | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1496 | muramyl tripeptide Click for more detail | Mycobacteria (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(COP(=O)(O)OCCNC(=O)C(C)NC(=O)CCC(C(=O)N)NC(=O)C(C)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C)OC(=O)CCCCCCCCCCCCCCC | NA | Peptide | Natural | in vitro activates Nod | PGLYRP-2 | Peptidoglycan Recognition Receptor (PGRPs) | Human | intraepithelial T lymphocytes | intracellular receptors | Q96PD5.fasta | Q96PD5 | 576 | recognises peptidoglycan of bacterial cell wall | NA | 24779390 | 2014 | Pubchem_assay |
| PRRID_1650 | Tri-DAP Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N | NA | Peptide | Natural | activate NF-κB | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Mice | macrophages and mesothelial cells | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q8BHB0.fasta | Q8BHB0 | 953 | interacts with IKK to trigger the activation of NF-kB and the production of inflammatory cytokines, such as TNF-a and IL-6 | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1650 | Tri-DAP Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N | NA | Peptide | Natural | activate NF-κB | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Mice | macrophages and mesothelial cells | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q8BHB0.fasta | Q8BHB0 | 953 | interacts with IKK to trigger the activation of NF-kB and the production of inflammatory cytokines, such as TNF-a and IL-6 | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1651 | Tri-DAP Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N | NA | Peptide | Natural | activate NF-κB | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | macrophages and mesothelial cells | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q8BHB0.fasta | Q8BHB0 | 953 | interacts with IKK to trigger the activation of NF-kB and the production of inflammatory cytokines, such as TNF-a and IL-6 | ELISA | 24766550 | 2014 | Pubchem_assay |
| PRRID_1651 | Tri-DAP Click for more detail | Gram-positive and negative bacteria | CC(C(=O)NC(CCC(=O)NC(CCCC(C(=O)O)N)C(=O)O)C(=O)O)N | NA | Peptide | Natural | activate NF-κB | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | macrophages and mesothelial cells | serine/threonine RIP2 (RICK, CARDIAK) kinase | Q8BHB0.fasta | Q8BHB0 | 953 | interacts with IKK to trigger the activation of NF-kB and the production of inflammatory cytokines, such as TNF-a and IL-6 | ELISA | 24766550 | 2014 | Pubchem_assay |