Primary information |
---|
PRRID | PRRID_0871 |
Ligand Name | beta-defensin |
Source | Endogenous (others) |
Sequence of ligand | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS |
Length | 69 |
Type | Peptide |
Occurence | Natural |
Role of Ligand | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | Myeloid cells, microglia, astrocytes, neurons |
Domain | NA |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | plays a fundamental role in pathogen recognition and activation of innate immunity |
Assay used | NA |
PMID | 21982558 |
Year of Publication | 2011 |
Pubchem assay | Pubchem Assay |
Primary information |
---|
PRRID | PRRID_0871 |
Ligand Name | beta-defensin |
Source | Endogenous (others) |
Sequence of ligand | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS |
Length | 69 |
Type | Peptide |
Occurence | Natural |
Role of Ligand | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | Myeloid cells, microglia, astrocytes, neurons |
Domain | NA |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | plays a fundamental role in pathogen recognition and activation of innate immunity |
Assay used | NA |
PMID | 21982558 |
Year of Publication | 2011 |
Pubchem assay | Pubchem Assay |