Detailed description page of PRRDB2.0
| This page displays user query in tabular form. |
PRRID_0871 details |
| Primary information | |
|---|---|
| PRRID | PRRID_0871 |
| Ligand Name | beta-defensin |
| Source | Endogenous (others) |
| Sequence of ligand | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS |
| Length | 69 |
| Type | Peptide |
| Occurence | Natural |
| Role of Ligand | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Myeloid cells, microglia, astrocytes, neurons |
| Domain | NA |
| Sequence of Receptor | O00206.fasta |
| Swiss prot ID | O00206 |
| Length Of Receptor | 839 |
| Function | plays a fundamental role in pathogen recognition and activation of innate immunity |
| Assay used | NA |
| PMID | 21982558 |
| Year of Publication | 2011 |
| Pubchem assay | Pubchem Assay |
| Primary information | |
|---|---|
| PRRID | PRRID_0871 |
| Ligand Name | beta-defensin |
| Source | Endogenous (others) |
| Sequence of ligand | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS |
| Length | 69 |
| Type | Peptide |
| Occurence | Natural |
| Role of Ligand | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Myeloid cells, microglia, astrocytes, neurons |
| Domain | NA |
| Sequence of Receptor | O00206.fasta |
| Swiss prot ID | O00206 |
| Length Of Receptor | 839 |
| Function | plays a fundamental role in pathogen recognition and activation of innate immunity |
| Assay used | NA |
| PMID | 21982558 |
| Year of Publication | 2011 |
| Pubchem assay | Pubchem Assay |