Detailed description page of PRRDB2.0
This page displays user query in tabular form. |
PRRID_1229 details |
Primary information | |
---|---|
PRRID | PRRID_1229 |
Ligand Name | Defensins |
Source | Host (Endogenous) (others) |
Sequence of ligand | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS |
Length | 69 |
Type | Peptide |
Occurence | Natural |
Role of Ligand | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Mice |
Localization | Keratinocytes and mouse skin |
Domain | cell surface |
Sequence of Receptor | Q9QUK6.fasta |
Swiss prot ID | Q9QUK6 |
Length Of Receptor | 835 |
Function | play a role in UVB induced immune suppression |
Assay used | NA |
PMID | 24786223 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |
Primary information | |
---|---|
PRRID | PRRID_1229 |
Ligand Name | Defensins |
Source | Host (Endogenous) (others) |
Sequence of ligand | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS |
Length | 69 |
Type | Peptide |
Occurence | Natural |
Role of Ligand | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Mice |
Localization | Keratinocytes and mouse skin |
Domain | cell surface |
Sequence of Receptor | Q9QUK6.fasta |
Swiss prot ID | Q9QUK6 |
Length Of Receptor | 835 |
Function | play a role in UVB induced immune suppression |
Assay used | NA |
PMID | 24786223 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |