Primary information |
---|
PRRID | PRRID_1230 |
Ligand Name | Defensins |
Source | Host (Endogenous) (others) |
Sequence of ligand | MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Length | 68 |
Type | Peptide |
Occurence | Natural |
Role of Ligand | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | Keratinocytes and mouse skin |
Domain | cell surface |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | play a role in UVB induced immune suppression |
Assay used | NA |
PMID | 24786223 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |
Primary information |
---|
PRRID | PRRID_1230 |
Ligand Name | Defensins |
Source | Host (Endogenous) (others) |
Sequence of ligand | MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Length | 68 |
Type | Peptide |
Occurence | Natural |
Role of Ligand | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | Keratinocytes and mouse skin |
Domain | cell surface |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | play a role in UVB induced immune suppression |
Assay used | NA |
PMID | 24786223 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |