Primary information |
---|
PRRID | PRRID_0415 |
Ligand Name | AtPep2 |
Source | NA |
Sequence of ligand | DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED |
Length | 36 |
Type | Peptide |
Occurence | Synthetic |
Role of Ligand | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. |
Name of receptor | PEPR1 |
Type of receptor | Toll-like receptor (TLR) |
Source | Arabidopsis |
Localization | Plasma membrane |
Domain | LRR |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | It caused seedling growth inhibition of arabidopsis thaliana |
Assay used | Growth inhibition assay |
PMID | 20200150 |
Year of Publication | 2010 |
Pubchem assay | NA |
Primary information |
---|
PRRID | PRRID_0415 |
Ligand Name | AtPep2 |
Source | NA |
Sequence of ligand | DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED |
Length | 36 |
Type | Peptide |
Occurence | Synthetic |
Role of Ligand | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. |
Name of receptor | PEPR1 |
Type of receptor | Toll-like receptor (TLR) |
Source | Arabidopsis |
Localization | Plasma membrane |
Domain | LRR |
Sequence of Receptor | NA |
Swiss prot ID | NA |
Length Of Receptor | NA |
Function | It caused seedling growth inhibition of arabidopsis thaliana |
Assay used | Growth inhibition assay |
PMID | 20200150 |
Year of Publication | 2010 |
Pubchem assay | NA |