| Primary information |
|---|
| PRRID | PRRID_0415 |
| Ligand Name | AtPep2 |
| Source | NA |
| Sequence of ligand | DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED |
| Length | 36 |
| Type | Peptide |
| Occurence | Synthetic |
| Role of Ligand | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. |
| Name of receptor | PEPR1 |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Arabidopsis |
| Localization | Plasma membrane |
| Domain | LRR |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | It caused seedling growth inhibition of arabidopsis thaliana |
| Assay used | Growth inhibition assay |
| PMID | 20200150 |
| Year of Publication | 2010 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_0415 |
| Ligand Name | AtPep2 |
| Source | NA |
| Sequence of ligand | DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED |
| Length | 36 |
| Type | Peptide |
| Occurence | Synthetic |
| Role of Ligand | It increase cytosolic calcium and activate chloride channels followed by membrane depolarization in a strictly receptor-dependent manner. |
| Name of receptor | PEPR1 |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Arabidopsis |
| Localization | Plasma membrane |
| Domain | LRR |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | It caused seedling growth inhibition of arabidopsis thaliana |
| Assay used | Growth inhibition assay |
| PMID | 20200150 |
| Year of Publication | 2010 |
| Pubchem assay | NA |