| Primary information |
|---|
| PRRID | PRRID_1137 |
| Ligand Name | Serum amyloid |
| Source | Gram-positive bacteria |
| Sequence of ligand | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Length | 122 |
| Type | Peptide |
| Occurence | Natural |
| Role of Ligand | Play an important role in infectious inflammatory responses. |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | monocyte/macrophages, DCs, B-lymphocytes |
| Domain | extracellular domains of leucine-rich repeat motifs |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | significant role in the pathogenesis of severe inflammatory responses |
| Assay used | NA |
| PMID | 23985302 |
| Year of Publication | 2013 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_1137 |
| Ligand Name | Serum amyloid |
| Source | Gram-positive bacteria |
| Sequence of ligand | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY |
| Length | 122 |
| Type | Peptide |
| Occurence | Natural |
| Role of Ligand | Play an important role in infectious inflammatory responses. |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | monocyte/macrophages, DCs, B-lymphocytes |
| Domain | extracellular domains of leucine-rich repeat motifs |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | significant role in the pathogenesis of severe inflammatory responses |
| Assay used | NA |
| PMID | 23985302 |
| Year of Publication | 2013 |
| Pubchem assay | NA |