| Primary information |
|---|
| PRRID | PRRID_1189 |
| Ligand Name | beta-defensin |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS |
| Length | 69 |
| Type | Peptide |
| Occurence | Natural |
| Role of Ligand | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses |
| Name of receptor | JNKBP1 |
| Type of receptor | Pattern recognition receptor (PRR) |
| Source | TLR-deficient Mice on a C57BL/6 |
| Localization | monocyte/macrophages |
| Domain | cell surface |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
| Assay used | ELISA |
| PMID | 24801735 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1189 |
| Ligand Name | beta-defensin |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS |
| Length | 69 |
| Type | Peptide |
| Occurence | Natural |
| Role of Ligand | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses |
| Name of receptor | JNKBP1 |
| Type of receptor | Pattern recognition receptor (PRR) |
| Source | TLR-deficient Mice on a C57BL/6 |
| Localization | monocyte/macrophages |
| Domain | cell surface |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
| Assay used | ELISA |
| PMID | 24801735 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |