Detailed description page of PRRDB2.0
This page displays user query in tabular form. |
PRRID_1189 details |
Primary information | |
---|---|
PRRID | PRRID_1189 |
Ligand Name | beta-defensin |
Source | Host (Endogenous) (others) |
Sequence of ligand | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS |
Length | 69 |
Type | Peptide |
Occurence | Natural |
Role of Ligand | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses |
Name of receptor | JNKBP1 |
Type of receptor | Pattern recognition receptor (PRR) |
Source | TLR-deficient Mice on a C57BL/6 |
Localization | monocyte/macrophages |
Domain | cell surface |
Sequence of Receptor | Q9QUK6.fasta |
Swiss prot ID | Q9QUK6 |
Length Of Receptor | 835 |
Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
Assay used | ELISA |
PMID | 24801735 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |
Primary information | |
---|---|
PRRID | PRRID_1189 |
Ligand Name | beta-defensin |
Source | Host (Endogenous) (others) |
Sequence of ligand | MKTHYFLLVMICFLFSQMEPGVGILTSLGRRTDQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS |
Length | 69 |
Type | Peptide |
Occurence | Natural |
Role of Ligand | Defensins are cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses |
Name of receptor | JNKBP1 |
Type of receptor | Pattern recognition receptor (PRR) |
Source | TLR-deficient Mice on a C57BL/6 |
Localization | monocyte/macrophages |
Domain | cell surface |
Sequence of Receptor | Q9QUK6.fasta |
Swiss prot ID | Q9QUK6 |
Length Of Receptor | 835 |
Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
Assay used | ELISA |
PMID | 24801735 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |