Please click on the ID to see detailed information about each entry.
The total number entries retrieved from this search are| ID1109 | SequenceYTSLIHSLIEESQNQQ EKNEQELLELDKWAS LWNWF | NameT20 | Nature of peptide or cargoFusion inhibitor | AssayReal-time PCR | Tissue permeabilityInduced a 50% inhibition of HIV-1JRCSF genomic integration in leukocytes residing within the vaginal epithelium (IC50) was 0.153 microM (0.687 ng/ml; 95% confidence interval, 0.563 to 0.84 ng/ml; n=7 independent experiments with 4 donor tissues. | Tissue SampleVaginal epithelial sheet | PUBMED ID19949052 |
| ID1110 | SequenceYTSLIHSLIEESQNQQ EKNEQELLELDKWAS LWNWF | NameN-acetylated T20 | Nature of peptide or cargoFusion inhibitor | AssayReal-time PCR | Tissue permeabilityIC50 of 51.2 microM (230 ng/ml; 95% confidence interval, 198 to 267 ng/ml; n 8 independent experiments with 4 donor tissues) | Tissue SampleVaginal epithelial sheet | PUBMED ID19949052 |
| ID1116 | SequenceAETTNTQQAHTQMSTQ SQDVSYGTYYTIDSNG DYHHTPDGNWNQAMFD NKEYSYTFVDAQGHTH YFYNCYPKNANANGSG QTYVNPATAGDNNDYT ASQSQQHINQYGYQSN VGPDASYYSHSNNNQAY NSHDGNGKVNYPNGTS NQNGGSASKATASGHA KDASWLTSRKQLQPYG QYHGGGAHYGVDYAMP ENSPVYSLTDGTVVQA GWSNYGGGNQVTIKEA NSNNYQWYMHNNRL | NameLysostaphin | Nature of peptide or cargoEndopeptidase,Antimicrobial | AssayFranz diffusion cell | Tissue permeabilityLysostaphin (1 mg l-1) caused a 1.95 ± 0.23 log10 CFU reduction in bacteria | Tissue SampleAbdominal skin from a 38-year-old white female donor | PUBMED ID19709343 |
| ID1123 | SequenceMNFVMISIELSETMAL IIVISGLLLCASSITT TSSNDFYAVLHGNLSQ SDRNELPKICGREFLT DTLQSRSAGGVLVREN EYPWVLLLTDPEWTRV CTAVLISRRHVLTAAH CVTNFPKDRKLEKDCH YTTIQSTYLYVYPRTR VNDALNIKRYTSSFSV ARVMVHPSFSCSNATG DIALLELTLNIFTEAS PICMPHFNESIPKNAA AAGFGKNPISNNTRPM QVVNLTYQGTTGDRI | NameTrypsin | Nature of peptide or cargoEndogenous proteases trypsin is capable of digesting intercellular desmosomal proteins and hence used for in vitro epidermal separation and keratinocyte isolation | AssayFranz diffusion cell | Tissue permeabilityPermeability coefficient at 0.25% trypsin pretreatment is 5.29 X 107cm/s,permeation flux increased 5.2-fold.A higher concentration of trypsin shortened the lag time of insulin permeation | Tissue SampleEpidermal skin of male wistar rat | PUBMED ID18670091 |
| ID1124 | SequenceMNFVMISIELSETMAL IIVISGLLLCASSITT TSSNDFYAVLHGNLSQ SDRNELPKICGREFLT DTLQSRSAGGVLVREN EYPWVLLLTDPEWTRV CTAVLISRRHVLTAAH CVTNFPKDRKLEKDCH YTTIQSTYLYVYPRTR VNDALNIKRYTSSFSV ARVMVHPSFSCSNATG DIALLELTLNIFTEAS PICMPHFNESIPKNAA AAGFGKNPISNNTRPM QVVNLTYQGTTGDRI | NameTrypsin | Nature of peptide or cargoEndogenous proteases trypsin is capable of digesting intercellular desmosomal proteins and hence used for in vitro epidermal separation and keratinocyte isolation | AssayFranz diffusion cell | Tissue permeabilityPermeation flux of insulin was 7.56 m g/cm2/h with 2.5% trypsin pretreatment, mean cumulative permeated amounts were 89.70 and 165.58 m g/cm2 at 12 and 24 h, respectively | Tissue SampleEpidermal skin of male wistar rat | PUBMED ID18670091 |
| ID1125 | SequenceMNFVMISIELSETMAL IIVISGLLLCASSITT TSSNDFYAVLHGNLSQ SDRNELPKICGREFLT DTLQSRSAGGVLVREN EYPWVLLLTDPEWTRV CTAVLISRRHVLTAAH CVTNFPKDRKLEKDCH YTTIQSTYLYVYPRTR VNDALNIKRYTSSFSV ARVMVHPSFSCSNATG DIALLELTLNIFTEAS PICMPHFNESIPKNAA AAGFGKNPISNNTRPM QVVNLTYQGTTGDRI | NameTrypsin | Nature of peptide or cargoEndogenous proteases trypsin is capable of digesting intercellular desmosomal proteins and hence used for in vitro epidermal separation and keratinocyte isolation | AssayLight microscope | Tissue permeabilitySignificant permeability of insulin and loosening of stratum corneum after trypsin application on the epidermal skin of rat can be seen in the microscopic images | Tissue SampleEpidermal skin of male wistar rat | PUBMED ID18670091 |
| ID1126 | SequenceMNFVMISIELSETMAL IIVISGLLLCASSITT TSSNDFYAVLHGNLSQ SDRNELPKICGREFLT DTLQSRSAGGVLVREN EYPWVLLLTDPEWTRV CTAVLISRRHVLTAAH CVTNFPKDRKLEKDCH YTTIQSTYLYVYPRTR VNDALNIKRYTSSFSV ARVMVHPSFSCSNATG DIALLELTLNIFTEAS PICMPHFNESIPKNAA AAGFGKNPISNNTRPM QVVNLTYQGTTGDRI | NameTrypsin | Nature of peptide or cargoEndogenous proteases trypsin is capable of digesting intercellular desmosomal proteins and hence used for in vitro epidermal separation and keratinocyte isolation | AssayPlasma glucose level (PGL) determination | Tissue permeabilityMarked decrease in the PGL was observed in the group with trypsin pretreatment. The PGL was reduced to less than 60% of the initial value after 8 h in all groups with trypsin pretreatment | Tissue SampleBlood collected from the tail vein of diabetic rat | PUBMED ID18670091 |
| ID1224 | Sequence(Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | NameInsulin in poloxamer gel 407 | Nature of peptide or cargoIt is used in the treatment diabetes mellitus and has immense therapeutic and commercial importance | AssayFranz diffusion cells, Radioimuunoassay | Tissue permeabilitySkin permeation parameters of insulin from poloxamer 407 gel using menthone enhancer, Lag time (h)=1.20 (0.02) , Flux (µg/cm2 /h)=5.57 (0.13), Cumulative amount permeated (µg)=210.78 (2.64), Skin affinity=10.57 (0.38), (P<0.05), all values are n=3 | Tissue SampleFemale Sprague–Dawley rat skin | PUBMED ID12695068 |
| ID1225 | Sequence(Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | NameInsulin in poloxamer gel 408 | Nature of peptide or cargoIt is used in the treatment diabetes mellitus and has immense therapeutic and commercial importance | AssayFranz diffusion cells, Radioimuunoassay | Tissue permeabilitySkin permeation parameters of insulin from poloxamer 407 gel using linoleic acid enhancer, Lag time (h)=0.65 (0.49) , Flux (µg/cm2 /h)=8.08 (0.20), Cumulative amount permeated (µg)=244.38 (30.21), Skin affinity=5.28 (2.37), (P<0.05), all values are n=3 | Tissue SampleFemale Sprague–Dawley rat skin | PUBMED ID12695068 |
| ID1355 | SequenceTFGSGEADCGLRPLFE KKSLEDKTERELLESY IDGRIVEGSDAEIGMS PWQVMLFRKSPQELLC GASLISDRWVLTAAHC LLYPPWDKNFTENDLL VRIGKHSRTRYERNIE KISMLEKIYIHPRYNW RENLDRDIALMKLKKP VAFSDYIHPVCLPDRE TAASLLQAGYKGRVTG WGNLKETWTANVGKGQ PSVLQVVNLPIVERPV CKDSTRIRITDNMFCA GYKPDEGKRGDACEG | NameHuman α thrombin | Nature of peptide or cargoThromboplastin activation product of prothrombin with high clotting and esterase activity. | AssayHistological examination and numerical scoring of cellular and tissue parameters of wound healing. A 7 day incisional breaking strength was measured. | Tissue permeability26% increase in breaking strength, P value of < 0.013, histology demonstrated a more advanced state of healing | Tissue SampleA single 6-cm vertical incision was made on the dorsal midline or a parallel pair of 6-cm incisions were cut 1.5 cm to either side of the midline of acclimatized adult male Harlan Sprague-Dawley rats. The wound was closed with three simple interrupted sutures placed 1.5cm apart and later received a single peptide dose. | PUBMED ID1373740 |
| ID1356 | SequenceTFGSGEADCGLRPLFE KKSLEDKTERELLESY IDGRIVEGSDAEIGMS PWQVMLFRKSPQELLC GASLISDRWVLTAAHC LLYPPWDKNFTENDLL VRIGKHSRTRYERNIE KISMLEKIYIHPRYNW RENLDRDIALMKLKKP VAFSDYIHPVCLPDRE TAASLLQAGYKGRVTG WGNLKETWTANVGKGQ PSVLQVVNLPIVERPV CKDSTRIRITDNMFCA GYKPDEGKRGDACEG | NameHuman α thrombin | Nature of peptide or cargoThromboplastin activation product of prothrombin with high clotting and esterase activity. | AssayHistological examination and numerical scoring of cellular and tissue parameters of wound healing. A 14 day incisional breaking strength was measured. | Tissue permeabilityIncreased breaking strength of approximately 60%, (P < 0.03) | Tissue SampleA single 6-cm vertical incision was made on the dorsal midline or a parallel pair of 6-cm incisions were cut 1.5 cm to either side of the midline of acclimatized adult male Harlan Sprague-Dawley rats. The wound was closed with three simple interrupted sutures placed 1.5cm apart and later received a single peptide dose. | PUBMED ID1373740 |
| ID1364 | SequenceGRKKRRQRRRPPQRKC MSKGEELFTGVVPILV ELDGDVNGHKFSVSGE GEGDATYGKLTLKFIC TTGKLPVPWPTLVTTF SYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQE RTIFFKDDGNYKTRAE VKFEGDTLVNRIELKG IDFKEDGNILGHKLEY NYNSHNVYIMADKQKN GIKVNFKIRHNIEDGS VQLADHYQQNTPIGDG PVLLPDNHYLSTQSAL SKDPNEKRDHMVLLEF | NameN-terminal Tat fusion green fluorescent protein (GFP) (TG) | Nature of peptide or cargoFluorescent CPP | AssayVertical Franz diffusion cell | Tissue permeabilityCumulative amounts 4.86 ± 0.55 µg/cm2 and fluxes 0.81 ± 0.09 µg/cm2·h for stratum corneum. The receiver compartment of Franz Diffusion Cells had cumulative amount=28.50 ± 12.07 µg/cm2 and fluxes= 4.75 ± 1.47 µg/cm2·h | Tissue SampleStratum corneum of the abdominal skin of Sparague-Dawley rats after shaving off hair | PUBMED ID20891012 |
| ID1365 | SequenceMSKGEELFTGVVPILV ELDGDVNGHKFSVSGE GEGDATYGKLTLKFIC TTGKLPVPWPTLVTTF SYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQER TIFFKDDGNYKTRAEV KFEGDTLVNRIELKGI DFKEDGNILGHKLEYN YNSHNVYIMADKQKNG IKVNFKIRHNIEDGSV QLADHYQQNTPIGDGP VLLPDNHYLSTQSALS KDPNEKRDHMVLLEFV TAAGITHGMDELYK | NameGFP | Nature of peptide or cargoFluorescent protein | AssayVertical Franz diffusion cell | Tissue permeabilityCumulative amounts 24.15 ± 7.28 µg/cm2 and fluxes 4.02 ± 1.21 µg/cm2·h for stratum corneum. The receiver compartment of Franz Diffusion Cells had cumulative amount=22.61 ± 2.87 µg/cm2 and fluxes= 3.77 ± 0.48 µg/cm2·h | Tissue SampleStratum corneum of the abdominal skin of Sparague-Dawley rats after shaving off hair | PUBMED ID20891012 |
| ID1366 | SequenceGRKKRRQRRRPPQRKC MSKGEELFTGVVPILV ELDGDVNGHKFSVSGE GEGDATYGKLTLKFIC TTGKLPVPWPTLVTTF SYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQE RTIFFKDDGNYKTRAE VKFEGDTLVNRIELKG IDFKEDGNILGHKLEY NYNSHNVYIMADKQKN GIKVNFKIRHNIEDGS VQLADHYQQNTPIGDG PVLLPDNHYLSTQSAL SKDPNEKRDHMVLLEF | NameN-terminal Tat fusion green fluorescent protein (GFP) (TG) | Nature of peptide or cargoFluorescent CPP | AssayVertical Franz diffusion cell | Tissue permeabilityCumulative amounts 6.06 ± 0.70 µg/cm2 and fluxes 1.01 ± 0.70 µg/cm2·h for viable epidermis and dermis of skin. | Tissue SampleViable epidermis and dermis of the abdominal skin of Sparague-Dawley rats after shaving off hair | PUBMED ID20891012 |
| ID1367 | SequenceMSKGEELFTGVVPILV ELDGDVNGHKFSVSGE GEGDATYGKLTLKFIC TTGKLPVPWPTLVTTF SYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQER TIFFKDDGNYKTRAEV KFEGDTLVNRIELKGI DFKEDGNILGHKLEYN YNSHNVYIMADKQKNG IKVNFKIRHNIEDGSV QLADHYQQNTPIGDGP VLLPDNHYLSTQSALS KDPNEKRDHMVLLEFV TAAGITHGMDELYK | NameGFP | Nature of peptide or cargoFluorescent protein | AssayVertical Franz diffusion cell | Tissue permeabilityCumulative amounts 17.92 ± 0.78 µg/cm2 and fluxes 2.99 ± 0.26 µg/cm2·h for viable epidermis and dermis of skin. | Tissue SampleViable epidermis and dermis of the abdominal skin of Sparague-Dawley rats after shaving off hair | PUBMED ID20891012 |
| ID1368 | SequenceGRKKRRQRRRPPQRKC MSKGEELFTGVVPILV ELDGDVNGHKFSVSGE GEGDATYGKLTLKFIC TTGKLPVPWPTLVTTF SYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQE RTIFFKDDGNYKTRAE VKFEGDTLVNRIELKG IDFKEDGNILGHKLEY NYNSHNVYIMADKQKN GIKVNFKIRHNIEDGS VQLADHYQQNTPIGDG PVLLPDNHYLSTQSAL SKDPNEKRDHMVLLEF | NameN-terminal Tat fusion green fluorescent protein (GFP) (TG) | Nature of peptide or cargoFluorescent CPP | AssayVertical Franz diffusion cell | Tissue permeabilityCumulative amounts 22.03 ± 4.01 µg/cm2 and fluxes 3.67 ± 2.33 µg/cm2·h for stratum corneum. The receiver compartment of Franz Diffusion Cells had cumulative amount=30.24 ± 4.81 µg/cm2 and fluxes= 5.04 ± 0.80 µg/cm2·h | Tissue SampleStratum corneum of the abdominal skin of Sparague-Dawley rats after shaving off hair | PUBMED ID20891012 |
| ID1369 | SequenceGRKKRRQRRRPPQRKC MSKGEELFTGVVPILV ELDGDVNGHKFSVSGE GEGDATYGKLTLKFIC TTGKLPVPWPTLVTTF SYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQE RTIFFKDDGNYKTRAE VKFEGDTLVNRIELKG IDFKEDGNILGHKLEY NYNSHNVYIMADKQKN GIKVNFKIRHNIEDGS VQLADHYQQNTPIGDG PVLLPDNHYLSTQSAL SKDPNEKRDHMVLLEF | NameN-terminal Tat fusion green fluorescent protein (GFP) (TG) | Nature of peptide or cargoFluorescent CPP | AssayVertical Franz diffusion cell | Tissue permeabilityCumulative amounts 8.59 ± 1.33 µg/cm2 and fluxes 1.43 ± 0.22 µg/cm2·h for stratum corneum. The receiver compartment of Franz Diffusion Cells had cumulative amount=62.75 ± 2.68 µg/cm2 and fluxes= 10.46 ± 3.45 µg/cm2·h | Tissue SampleStratum corneum of the abdominal skin of Sparague-Dawley rats after shaving off hair | PUBMED ID20891012 |
| ID1377 | SequenceCDLPQTHSLGSRRTLM LLAQMRKISLFSCLKD RHDFGFPQEEFGNQFQ KAETIPVLHEMIQQIF NLFSTKDSSAAWDETL LDKFYTELYQQLNDLE ACVIQGVGVTETPLMK EDSILAVRKYFQRITL YLKEKKYSPCAWEVVR AEIMRSFSLSTNLQES LRSKE | NameInterferon Alpha (IFN α) | Nature of peptide or cargoAntiviral, antiproliferative, and immunomodulatory properties | AssayELISA and antiviral assay | Tissue permeabilityAntiviral assay showed an average IFN α levels of 380±60 IU/mg protein in skin homogenate. ELISA of skin homogenate increased the IFNα levels from <12.5pg/mg tissue to 122.4±25.9 pg/mg tissue. | Tissue SampleHuman skin biopsy samples | PUBMED ID21291377 |
| ID1378 | SequenceCDLPQTHSLGSRRTLM LLAQMRKISLFSCLKD RHDFGFPQEEFGNQFQ KAETIPVLHEMIQQIF NLFSTKDSSAAWDETL LDKFYTELYQQLNDLE ACVIQGVGVTETPLMK EDSILAVRKYFQRITL YLKEKKYSPCAWEVVR AEIMRSFSLSTNLQES LRSKE | NameInterferon Alpha (IFN α) | Nature of peptide or cargoAntiviral, antiproliferative, and immunomodulatory properties | AssayELISA and antiviral assay | Tissue permeabilityAntiviral assay showed an average IFN α levels of 120±30 IU/mg protein in skin homogenate. ELISA of skin homogenate increased the IFNα levels from <12.5pg/mg tissue to 40.1±12.8 pg/mg tissue. | Tissue SampleHuman skin biopsy samples | PUBMED ID21291377 |
| ID1379 | SequenceCDLPQTHSLGSRRTLM LLAQMRKISLFSCLKD RHDFGFPQEEFGNQFQ KAETIPVLHEMIQQIF NLFSTKDSSAAWDETL LDKFYTELYQQLNDLE ACVIQGVGVTETPLMK EDSILAVRKYFQRITL YLKEKKYSPCAWEVVR AEIMRSFSLSTNLQES LRSKE | NameInterferon Alpha (IFN α) | Nature of peptide or cargoAntiviral, antiproliferative, and immunomodulatory properties | AssayELISA and antiviral assay | Tissue permeabilityAntiviral assay showed an average IFN α levels of 400±80 IU/mg protein in skin homogenate. ELISA of skin homogenate increased the IFNα levels from <12.5pg/mg tissue to 107.5±18.1 pg/mg tissue. | Tissue SampleHuman skin biopsy samples | PUBMED ID21291377 |
| ID1397 | SequenceBotulinum neurotoxin A light chain (PFVNKQF NYKDPVNGVDIAYIKIPN AGQMQPVKAFKIHNKI WVIPERDTFTNPEEGD LNPPPEAKQVPVSYY DSTYLSTDNEKDNYLK GVTKLFERIYSTDLGR MLLTSIVRGIPFWGG STIDTELKVIDTNCIN VIQPDGSYRSEE LNLVIIGPSADIIQFE CKSFGHEVLNLTRNGY GSTQYIRFSPDFT FGFEESLEVDTNPLL | NameBotulinum toxin type A | Nature of peptide or cargoPotent inhibitor of cholinergic motor nerves. | AssayWeights of the nasal secretion were collected and compared. | Tissue permeabilityTopically applied botulinum toxin reduced neurally evoked rhinorrhea by an average of 41%. | Tissue SampleNasal cavity of male mongrel dogs | PUBMED ID7700663 |
| ID1402 | Sequence(Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | NameInsulin | Nature of peptide or cargoInsulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | AssayChloride in the sweat determined by titration with a Cotiove chloridometer | Tissue permeabilityControl/Cystic fibrosis patients: 14.81±2.39/79.70±3.59(Vehicle treated) and 14.47±2.66/68.07±3.29(Insulin treated) | Tissue SampleStratum corneum of arm of cystic fibrosis patients | PUBMED ID1144451 |
| ID1403 | Sequence(Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | NameInsulin | Nature of peptide or cargoInsulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | AssayChloride in the sweat determined by titration with a Cotiove chloridometer | Tissue permeabilityControl/Cystic fibrosis patients: 14.81±2.39/16.03±2.34(Vehicle treated) and 14.47±2.66/11.52±1.28(Insulin treated) | Tissue SampleStratum corneum of arm of cystic fibrosis patients | PUBMED ID1144451 |
| ID1436 | SequenceACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | Nameα-CGRP (α-calcitonin gene-related peptide) | Nature of peptide or cargoSpecific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | AssayIntraocular pressure (IOP) calculated electromanometrically, blood-aqueous barrier, pupil size, blood pressure and cyclic AMP (CAMP) content in the aqueous humour of rabbits via 125I-radioimmunoassay | Tissue permeabilityIOP:Control=1.8mmHg, Neutral formaldehyde=From the baseline of 16.9±1.5 it rose by 27.3±3.8mmHg in 15.1±1.8 minutes, CGRP(0.5µg)=From the baseline of 18.5±1.1 it rose by 11.8±2.3mmHg in 15.0±2 minutes; Mean arterial blood pressure:Control=94±12/101±10(before), Formaldehyde=92±5/95±3(before), CGRP=94±5/98±4(before); cAMP after 30 minutes:Control=16.3±3.6pmol/ml, Formaldehyde right eye=88.5±35pmol/ml, Formaldehyde left e | Tissue SampleAlbino rabbits of both sexes weighing 2.2-3.1 kg were used. Right eye=Contralateral eye and left eye=Experimental. | PUBMED ID2842178 |
| ID1437 | SequenceACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | Nameα-CGRP (α-calcitonin gene-related peptide) | Nature of peptide or cargoSpecific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | AssayIntraocular pressure (IOP) calculated electromanometrically, blood-aqueous barrier, pupil size, blood pressure and cyclic AMP (CAMP) content in the aqueous humour of rabbits via 125I-radioimmunoassay | Tissue permeabilityIOP:Control=1.8mmHg, Neutral formaldehyde=From the baseline of 16.9±1.5 it rose by 27.3±3.8mmHg in 15.1±1.8 minutes, CGRP(2.0µg)=From the baseline of 17.5±0.9 it rose by 19.3±3.6mmHg in 6.3±1.5 minutes; Mean arterial blood pressure:Control=94±12/101±10(before), Formaldehyde=92±5/95±3(before), CGRP=85±6/104±5(before); cAMP after 30 minutes:Control=16.3±3.6pmol/ml, Formaldehyde right eye=88.5±35pmol/ml, Formaldehyde left | Tissue SampleAlbino rabbits of both sexes weighing 2.2-3.1 kg were used. Right eye=Contralateral eye and left eye=Experimental. | PUBMED ID2842178 |
| ID1438 | SequenceACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | Nameα-CGRP (α-calcitonin gene-related peptide) | Nature of peptide or cargoSpecific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | AssayRadio-actively labelled microspheres were used to determine blood flow | Tissue permeabilityRegional blood flow in anterior uvea(iris+ciliary body): For CGRP it rose by 244.8±80.2mg/minute/whole tissue, For saline it rose by 33.8±16.2mg/minute/whole tissue | Tissue SampleEyes of New Zealand albino rabbits | PUBMED ID3262039 |
| ID1439 | SequenceACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | Nameα-CGRP (α-calcitonin gene-related peptide) | Nature of peptide or cargoSpecific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | AssayRadio-actively labelled microspheres were used to determine blood flow | Tissue permeabilityRegional blood flow in anterior uvea(iris+ciliary body): For CGRP it rose by 244.8±80.2mg/minute/whole tissue, For saline it rose by 33.8±16.2mg/minute/whole tissue, For methysergide it rose by 54.1±23.3mg/minute/whole tissue | Tissue SampleEyes of New Zealand albino rabbits | PUBMED ID3262039 |
| ID1440 | SequenceACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | Nameα-CGRP (α-calcitonin gene-related peptide) | Nature of peptide or cargoSpecific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | AssayLowry method for protein estimation, cAMP content via 125I-radioimmunoassay, Electromanometrical recording intraocular pressure | Tissue permeabilityProtein=23.7±2.3mg/ml, cAMP=243.2±37.9pmol/ml, Intraocular pressure=22mmHg at 5 min, 28mmHg at 10 min, 37mmHg at 15 min, 38mmHg at 28 min, 35mmHg at 30 minutes. | Tissue SampleEyes of New Zealand albino rabbits | PUBMED ID3262039 |
| ID1441 | SequenceACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | Nameα-CGRP (α-calcitonin gene-related peptide) | Nature of peptide or cargoSpecific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | AssayLowry method for protein estimation, cAMP content via 125I-radioimmunoassay, Electromanometrical recording intraocular pressure | Tissue permeabilityProtein=13.3±6.2mg/ml, cAMP=147.0±7.4pmol/ml, Intraocular pressure=19mmHg at 5 min, 21mmHg at 10 min, 26mmHg at 15 min, 31mmHg at 28 min, 35.5mmHg at 30 minutes. | Tissue SampleEyes of New Zealand albino rabbits | PUBMED ID3262039 |
| ID1442 | SequenceACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | Nameα-CGRP (α-calcitonin gene-related peptide) | Nature of peptide or cargoSpecific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | AssayLowry method for protein estimation, cAMP content via 125I-radioimmunoassay, Electromanometrical recording intraocular pressure | Tissue permeabilityProtein=0.6±0.04mg/ml, cAMP=34.6±3.1pmol/ml, Intraocular pressure=18mmHg at 5 min, 17mmHg at 10 min, 16.1mmHg at 15 min, 15.9mmHg at 28 min, 15.5mmHg at 30 minutes. | Tissue SampleEyes of New Zealand albino rabbits | PUBMED ID3262039 |
| ID1443 | SequenceACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | Nameα-CGRP (α-calcitonin gene-related peptide) | Nature of peptide or cargoSpecific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | AssayLowry method for protein estimation, cAMP content via 125I-radioimmunoassay, Electromanometrical recording intraocular pressure | Tissue permeabilityProtein=0.6±0.1mg/ml, cAMP=65.3±14.7pmol/ml, Intraocular pressure=14.5mmHg at 5 min, 13mmHg at 10 min, 12.8mmHg at 15 min, 12.5mmHg at 28 min, 13.1mmHg at 30 minutes. | Tissue SampleEyes of New Zealand albino rabbits | PUBMED ID3262039 |
| ID1515 | SequenceSSSHPIFHRGEFSVCD SVSVWVGDKTTATDIK GKEVMVLGEVNINNSV FKQYFFETKCRDPNPV DSGCRGIDSKHWNSYC TTTHTFVKALTMDGKQ AAWRFIRIDTACVCVL SRKAVRRA | NameNerve Growth Factor | Nature of peptide or cargoNeurotrophic and immunomodulatory mediator responsible for the growth, differentiation, and survival of sensory neurons and acceleration of wound healing | AssayImmunostaining | Tissue permeabilityThe average subbasal tubulin positive nerve bundle area in controls was 0.85. Treatment with NGF produced significant differences with respect to the control (P < 0.05). | Tissue SampleRabbit eye | PUBMED ID16123410 |
| ID1526 | SequenceALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | NameFlagellin | Nature of peptide or cargoTopical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | AssayFungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Tissue permeabilityClinical score: Flagellin treated-2/PBS-6.2, Fungal clearance: Flagellin-3/PBS-0.5CFU(1000) of C. albicans per cornea, Reduced cytokine production and PMN infiltration= MIP-2:Flagellin-0/PBS-75pg/µg protein; ELISA:Flagellin has less content of the protein under study than present in PBS; MPO activity per cornea: Flagellin has less activity as compared to PBS control. | Tissue SampleEyes of wild type C57BL6 mice | PUBMED ID21310913 |
| ID1527 | SequenceALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | NameFlagellin | Nature of peptide or cargoTopical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | AssayFungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Tissue permeabilityClinical score: Flagellin treated-1-2/PBS-6-7, Fungal clearance: Flagellin-0/PBS-1.7CFU(1000) of C. albicans per cornea, Reduced cytokine production and PMN infiltration= MIP-2:Flagellin-0/PBS-5pg/µg protein; ELISA:Flagellin has less content of the protein under study than present in PBS; MPO activity per cornea: Flagellin has almost negligible activity as compared to PBS control. | Tissue SampleEyes of wild type C57BL6 mice | PUBMED ID21310913 |
| ID1528 | SequenceALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | NameFlagellin | Nature of peptide or cargoTopical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | AssayFungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Tissue permeabilityClinical score: Flagellin treated- ~0/PBS-5.8 | Tissue SampleEyes of wild type C57BL6 mice | PUBMED ID21310913 |
| ID1529 | SequenceALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | NameFlagellin | Nature of peptide or cargoTopical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | AssayFungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Tissue permeabilityFungal clearance: Flagellin-2/PBS-6CFU(1000) of C. albicans per cornea, Reduced cytokine production and PMN infiltration= MIP-2:Flagellin-9.5/PBS-7pg/µg protein; ELISA:Flagellin has more content of the protein under study than present in PBS; MPO activity per cornea: Flagellin has more activity as compared to PBS control. | Tissue SampleEyes of wild type C57BL6 mice | PUBMED ID21310913 |
| ID1530 | SequenceALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | NameFlagellin | Nature of peptide or cargoTopical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | AssayFungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Tissue permeabilityClinical score of Flagellin is slightly more than PBS control, both approximating to 9.1 and 8.9 respectively. | Tissue SampleEyes of TLR5-/- mouse breeding pairs | PUBMED ID21310913 |
| ID1531 | SequenceALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | NameFlagellin | Nature of peptide or cargoTopical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | AssayFungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Tissue permeabilityClinical score: Flagellin-11.1/PBS-10.9; CFU(1000) of C. albicans per cornea-Flagellin-3.4/PBS-4.2; MPO activity per cornea: Flagellin-23/PBS-19. | Tissue SampleEyes of TLR5-/- mouse breeding pairs | PUBMED ID21310913 |
| ID1532 | SequenceALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | NameFlagellin | Nature of peptide or cargoTopical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | AssayFungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Tissue permeabilityCamp-/- mouse corneas were more susceptible than the wild type to C. albicans. Mean clinical scores after infection with 1.0*104 CFU of C. albicans are: Wild type-5.3, KO-9.4 | Tissue SampleEyes of Camp-/- [CRAMP-deficient] mouse breeding pairs on a B6 background | PUBMED ID21310913 |
| ID1533 | SequenceALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | NameFlagellin | Nature of peptide or cargoTopical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | AssayFungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Tissue permeabilityCamp-/- mouse corneas were more susceptible than the wild type to C. albicans. Mean clinical scores after infection with 1.0*104 CFU of C. albicans are: Wild type-5.8, KO-11.6 | Tissue SampleEyes of Camp-/- [CRAMP-deficient] mouse breeding pairs on a B6 background | PUBMED ID21310913 |
| ID1534 | SequenceALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | NameFlagellin | Nature of peptide or cargoTopical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | AssayFungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Tissue permeabilityCamp-/- mouse corneas were more susceptible than the wild type to C. albicans. Mean clinical scores after infection with 1.0*104 CFU of C. albicans are: Wild type-2.9, KO-11.8 | Tissue SampleEyes of Camp-/- [CRAMP-deficient] mouse breeding pairs on a B6 background | PUBMED ID21310913 |
| ID1535 | SequenceALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | NameFlagellin | Nature of peptide or cargoTopical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | AssayFungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Tissue permeabilityCamp-/- mouse corneas were more susceptible than the wild type to C. albicans. Mean clinical scores after infection with 1.0*105 CFU of C. albicans are: Wild type-8.7, KO-9.8 | Tissue SampleEyes of Camp-/- [CRAMP-deficient] mouse breeding pairs on a B6 background | PUBMED ID21310913 |
| ID1536 | SequenceALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | NameFlagellin | Nature of peptide or cargoTopical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | AssayFungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Tissue permeabilityCamp-/- mouse corneas were more susceptible than the wild type to C. albicans. Mean clinical scores after infection with 1.0*105 CFU of C. albicans are: Wild type-9.3, KO-12 | Tissue SampleEyes of Camp-/- [CRAMP-deficient] mouse breeding pairs on a B6 background | PUBMED ID21310913 |
| ID1537 | SequenceALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | NameFlagellin | Nature of peptide or cargoTopical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | AssayFungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Tissue permeabilityCamp-/- mouse corneas were more susceptible than the wild type to C. albicans. Mean clinical scores after infection with 1.0*105 CFU of C. albicans are: Wild type-9.1, KO-11.9 | Tissue SampleEyes of Camp-/- [CRAMP-deficient] mouse breeding pairs on a B6 background | PUBMED ID21310913 |
| ID1538 | SequenceQNPASPPEEGSPDPDSTGA LVEEEDPFFKVPVNKLA AAVSNFGYDLYRVRSSTS PTTNVLLSPLSVATAL SALSLGAEQRTESIIHR ALYYDLISSPDIHGTYKEL LDTVTAPQKNLKSAS RIVFEKKLRIKSSFVAPLE KSYGTRPRVLTGNP RLDLQEINNWVQAQ MKGKLARSTKEIPDEIS ILLLGVAHFKGQWVTKF DSRKTSLEDFYLDEER TVRVPMMSDPKAVLR YGLDSD | NamePEDF (Pigment epithelium-derived factor) | Nature of peptide or cargoIt induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. | AssayVEGF and 8-OHdG Immunostaining, Measurement of corneal neo-vascularization via avidin-biotin-alkaline phosphatase kit and statistical analysis | Tissue permeabilityNeo-vascularized area= 2% due to PEDF (PBS=3%) | Tissue SampleSeven week-old male Spraque–Dawley rat's right eye was used as test and left eye considered as control (PBS) | PUBMED ID22386653 |
| ID1539 | SequenceQNPASPPEEGSPDPDSTGA LVEEEDPFFKVPVNKLA AAVSNFGYDLYRVRSSTS PTTNVLLSPLSVATAL SALSLGAEQRTESIIHR ALYYDLISSPDIHGTYKEL LDTVTAPQKNLKSAS RIVFEKKLRIKSSFVAPLE KSYGTRPRVLTGNP RLDLQEINNWVQAQ MKGKLARSTKEIPDEIS ILLLGVAHFKGQWVTKF DSRKTSLEDFYLDEER TVRVPMMSDPKAVLR YGLDSD | NamePEDF (Pigment epithelium-derived factor) | Nature of peptide or cargoIt induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. | AssayVEGF and 8-OHdG Immunostaining, Measurement of corneal neo-vascularization via avidin-biotin-alkaline phosphatase kit and statistical analysis | Tissue permeabilityNeo-vascularized area= 9% due to PEDF (PBS=10%) | Tissue SampleSeven week-old male Spraque–Dawley rat's right eye was used as test and left eye considered as control (PBS) | PUBMED ID22386653 |
| ID1540 | SequenceQNPASPPEEGSPDPDSTGA LVEEEDPFFKVPVNKLA AAVSNFGYDLYRVRSSTS PTTNVLLSPLSVATAL SALSLGAEQRTESIIHR ALYYDLISSPDIHGTYKEL LDTVTAPQKNLKSAS RIVFEKKLRIKSSFVAPLE KSYGTRPRVLTGNP RLDLQEINNWVQAQ MKGKLARSTKEIPDEIS ILLLGVAHFKGQWVTKF DSRKTSLEDFYLDEER TVRVPMMSDPKAVLR YGLDSD | NamePEDF (Pigment epithelium-derived factor) | Nature of peptide or cargoIt induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. | AssayVEGF and 8-OHdG Immunostaining, Measurement of corneal neo-vascularization via avidin-biotin-alkaline phosphatase kit and statistical analysis | Tissue permeabilityNeo-vascularized area= 18% due to PEDF (PBS=20%) | Tissue SampleSeven week-old male Spraque–Dawley rat's right eye was used as test and left eye considered as control (PBS) | PUBMED ID22386653 |
| ID1541 | SequenceQNPASPPEEGSPDPDSTGA LVEEEDPFFKVPVNKLA AAVSNFGYDLYRVRSSTS PTTNVLLSPLSVATAL SALSLGAEQRTESIIHR ALYYDLISSPDIHGTYKEL LDTVTAPQKNLKSAS RIVFEKKLRIKSSFVAPLE KSYGTRPRVLTGNP RLDLQEINNWVQAQ MKGKLARSTKEIPDEIS ILLLGVAHFKGQWVTKF DSRKTSLEDFYLDEER TVRVPMMSDPKAVLR YGLDSD | NamePEDF (Pigment epithelium-derived factor) | Nature of peptide or cargoIt induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. | AssayVEGF and 8-OHdG Immunostaining, Measurement of corneal neo-vascularization via avidin-biotin-alkaline phosphatase kit and statistical analysis | Tissue permeabilityNeo-vascularized area= 22% due to PEDF (PBS=31%) or 65% of PBS on day 7(Control=4% of PBS); Oxidative stress generation, 8-OHdG level=75% of PBS (Control=50% of PBS); VEGF expression, VEGF level=71% of PBS (Control=40% of PBS) | Tissue SampleSeven week-old male Spraque–Dawley rat's right eye was used as test and left eye considered as control (PBS) | PUBMED ID22386653 |
| ID1614 | SequenceLLGDFFRKSKEKIGK EFKRIVQRIKDFLRN LVPRTES | NameLL-37 | Nature of peptide or cargoNot mentioned | AssayStatistical analysis was done in order to measure the efficacy of LL-37 as a drug. | Tissue permeabilityThe ulcers reduced to 32% | Tissue SampleHuman skin | PUBMED ID25041740 |
| ID1615 | SequenceLLGDFFRKSKEKIGK EFKRIVQRIKDFLRN LVPRTES | NameLL-37 | Nature of peptide or cargoNot mentioned | AssayStatistical analysis was done in order to measure the efficacy of LL-37 as a drug. | Tissue permeabilityThe ulcers decreased to 50% | Tissue SampleHuman skin | PUBMED ID25041740 |