Please click on the ID to see detailed information about each entry.
The total number entries retrieved from this search are| ID | Sequence | Name | Nature of peptide or cargo | Assay | Tissue permeability | Tissue Sample | PUBMED ID |
|---|---|---|---|---|---|---|---|
| 1109 | YTSLIHSLIEESQNQQ EKNEQELLELDKWAS LWNWF | T20 | Fusion inhibitor | Real-time PCR | Induced a 50% inhibition of HIV-1JRCSF genomic integration in leukocytes residing within the vaginal epithelium (IC50) was 0.153 microM (0.687 ng/ml; 95% confidence interval, 0.563 to 0.84 ng/ml; n=7 independent experiments with 4 donor tissues. | Vaginal epithelial sheet | 19949052 |
| 1110 | YTSLIHSLIEESQNQQ EKNEQELLELDKWAS LWNWF | N-acetylated T20 | Fusion inhibitor | Real-time PCR | IC50 of 51.2 microM (230 ng/ml; 95% confidence interval, 198 to 267 ng/ml; n 8 independent experiments with 4 donor tissues) | Vaginal epithelial sheet | 19949052 |
| 1116 | AETTNTQQAHTQMSTQ SQDVSYGTYYTIDSNG DYHHTPDGNWNQAMFD NKEYSYTFVDAQGHTH YFYNCYPKNANANGSG QTYVNPATAGDNNDYT ASQSQQHINQYGYQSN VGPDASYYSHSNNNQAY NSHDGNGKVNYPNGTS NQNGGSASKATASGHA KDASWLTSRKQLQPYG QYHGGGAHYGVDYAMP ENSPVYSLTDGTVVQA GWSNYGGGNQVTIKEA NSNNYQWYMHNNRL | Lysostaphin | Endopeptidase,Antimicrobial | Franz diffusion cell | Lysostaphin (1 mg l-1) caused a 1.95 ± 0.23 log10 CFU reduction in bacteria | Abdominal skin from a 38-year-old white female donor | 19709343 |
| 1123 | MNFVMISIELSETMAL IIVISGLLLCASSITT TSSNDFYAVLHGNLSQ SDRNELPKICGREFLT DTLQSRSAGGVLVREN EYPWVLLLTDPEWTRV CTAVLISRRHVLTAAH CVTNFPKDRKLEKDCH YTTIQSTYLYVYPRTR VNDALNIKRYTSSFSV ARVMVHPSFSCSNATG DIALLELTLNIFTEAS PICMPHFNESIPKNAA AAGFGKNPISNNTRPM QVVNLTYQGTTGDRI | Trypsin | Endogenous proteases trypsin is capable of digesting intercellular desmosomal proteins and hence used for in vitro epidermal separation and keratinocyte isolation | Franz diffusion cell | Permeability coefficient at 0.25% trypsin pretreatment is 5.29 X 107cm/s,permeation flux increased 5.2-fold.A higher concentration of trypsin shortened the lag time of insulin permeation | Epidermal skin of male wistar rat | 18670091 |
| 1124 | MNFVMISIELSETMAL IIVISGLLLCASSITT TSSNDFYAVLHGNLSQ SDRNELPKICGREFLT DTLQSRSAGGVLVREN EYPWVLLLTDPEWTRV CTAVLISRRHVLTAAH CVTNFPKDRKLEKDCH YTTIQSTYLYVYPRTR VNDALNIKRYTSSFSV ARVMVHPSFSCSNATG DIALLELTLNIFTEAS PICMPHFNESIPKNAA AAGFGKNPISNNTRPM QVVNLTYQGTTGDRI | Trypsin | Endogenous proteases trypsin is capable of digesting intercellular desmosomal proteins and hence used for in vitro epidermal separation and keratinocyte isolation | Franz diffusion cell | Permeation flux of insulin was 7.56 m g/cm2/h with 2.5% trypsin pretreatment, mean cumulative permeated amounts were 89.70 and 165.58 m g/cm2 at 12 and 24 h, respectively | Epidermal skin of male wistar rat | 18670091 |
| 1125 | MNFVMISIELSETMAL IIVISGLLLCASSITT TSSNDFYAVLHGNLSQ SDRNELPKICGREFLT DTLQSRSAGGVLVREN EYPWVLLLTDPEWTRV CTAVLISRRHVLTAAH CVTNFPKDRKLEKDCH YTTIQSTYLYVYPRTR VNDALNIKRYTSSFSV ARVMVHPSFSCSNATG DIALLELTLNIFTEAS PICMPHFNESIPKNAA AAGFGKNPISNNTRPM QVVNLTYQGTTGDRI | Trypsin | Endogenous proteases trypsin is capable of digesting intercellular desmosomal proteins and hence used for in vitro epidermal separation and keratinocyte isolation | Light microscope | Significant permeability of insulin and loosening of stratum corneum after trypsin application on the epidermal skin of rat can be seen in the microscopic images | Epidermal skin of male wistar rat | 18670091 |
| 1126 | MNFVMISIELSETMAL IIVISGLLLCASSITT TSSNDFYAVLHGNLSQ SDRNELPKICGREFLT DTLQSRSAGGVLVREN EYPWVLLLTDPEWTRV CTAVLISRRHVLTAAH CVTNFPKDRKLEKDCH YTTIQSTYLYVYPRTR VNDALNIKRYTSSFSV ARVMVHPSFSCSNATG DIALLELTLNIFTEAS PICMPHFNESIPKNAA AAGFGKNPISNNTRPM QVVNLTYQGTTGDRI | Trypsin | Endogenous proteases trypsin is capable of digesting intercellular desmosomal proteins and hence used for in vitro epidermal separation and keratinocyte isolation | Plasma glucose level (PGL) determination | Marked decrease in the PGL was observed in the group with trypsin pretreatment. The PGL was reduced to less than 60% of the initial value after 8 h in all groups with trypsin pretreatment | Blood collected from the tail vein of diabetic rat | 18670091 |
| 1224 | (Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | Insulin in poloxamer gel 407 | It is used in the treatment diabetes mellitus and has immense therapeutic and commercial importance | Franz diffusion cells, Radioimuunoassay | Skin permeation parameters of insulin from poloxamer 407 gel using menthone enhancer, Lag time (h)=1.20 (0.02) , Flux (µg/cm2 /h)=5.57 (0.13), Cumulative amount permeated (µg)=210.78 (2.64), Skin affinity=10.57 (0.38), (P<0.05), all values are n=3 | Female Sprague–Dawley rat skin | 12695068 |
| 1225 | (Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | Insulin in poloxamer gel 408 | It is used in the treatment diabetes mellitus and has immense therapeutic and commercial importance | Franz diffusion cells, Radioimuunoassay | Skin permeation parameters of insulin from poloxamer 407 gel using linoleic acid enhancer, Lag time (h)=0.65 (0.49) , Flux (µg/cm2 /h)=8.08 (0.20), Cumulative amount permeated (µg)=244.38 (30.21), Skin affinity=5.28 (2.37), (P<0.05), all values are n=3 | Female Sprague–Dawley rat skin | 12695068 |
| 1355 | TFGSGEADCGLRPLFE KKSLEDKTERELLESY IDGRIVEGSDAEIGMS PWQVMLFRKSPQELLC GASLISDRWVLTAAHC LLYPPWDKNFTENDLL VRIGKHSRTRYERNIE KISMLEKIYIHPRYNW RENLDRDIALMKLKKP VAFSDYIHPVCLPDRE TAASLLQAGYKGRVTG WGNLKETWTANVGKGQ PSVLQVVNLPIVERPV CKDSTRIRITDNMFCA GYKPDEGKRGDACEG | Human α thrombin | Thromboplastin activation product of prothrombin with high clotting and esterase activity. | Histological examination and numerical scoring of cellular and tissue parameters of wound healing. A 7 day incisional breaking strength was measured. | 26% increase in breaking strength, P value of < 0.013, histology demonstrated a more advanced state of healing | A single 6-cm vertical incision was made on the dorsal midline or a parallel pair of 6-cm incisions were cut 1.5 cm to either side of the midline of acclimatized adult male Harlan Sprague-Dawley rats. The wound was closed with three simple interrupted sutures placed 1.5cm apart and later received a single peptide dose. | 1373740 |
| 1356 | TFGSGEADCGLRPLFE KKSLEDKTERELLESY IDGRIVEGSDAEIGMS PWQVMLFRKSPQELLC GASLISDRWVLTAAHC LLYPPWDKNFTENDLL VRIGKHSRTRYERNIE KISMLEKIYIHPRYNW RENLDRDIALMKLKKP VAFSDYIHPVCLPDRE TAASLLQAGYKGRVTG WGNLKETWTANVGKGQ PSVLQVVNLPIVERPV CKDSTRIRITDNMFCA GYKPDEGKRGDACEG | Human α thrombin | Thromboplastin activation product of prothrombin with high clotting and esterase activity. | Histological examination and numerical scoring of cellular and tissue parameters of wound healing. A 14 day incisional breaking strength was measured. | Increased breaking strength of approximately 60%, (P < 0.03) | A single 6-cm vertical incision was made on the dorsal midline or a parallel pair of 6-cm incisions were cut 1.5 cm to either side of the midline of acclimatized adult male Harlan Sprague-Dawley rats. The wound was closed with three simple interrupted sutures placed 1.5cm apart and later received a single peptide dose. | 1373740 |
| 1364 | GRKKRRQRRRPPQRKC MSKGEELFTGVVPILV ELDGDVNGHKFSVSGE GEGDATYGKLTLKFIC TTGKLPVPWPTLVTTF SYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQE RTIFFKDDGNYKTRAE VKFEGDTLVNRIELKG IDFKEDGNILGHKLEY NYNSHNVYIMADKQKN GIKVNFKIRHNIEDGS VQLADHYQQNTPIGDG PVLLPDNHYLSTQSAL SKDPNEKRDHMVLLEF | N-terminal Tat fusion green fluorescent protein (GFP) (TG) | Fluorescent CPP | Vertical Franz diffusion cell | Cumulative amounts 4.86 ± 0.55 µg/cm2 and fluxes 0.81 ± 0.09 µg/cm2·h for stratum corneum. The receiver compartment of Franz Diffusion Cells had cumulative amount=28.50 ± 12.07 µg/cm2 and fluxes= 4.75 ± 1.47 µg/cm2·h | Stratum corneum of the abdominal skin of Sparague-Dawley rats after shaving off hair | 20891012 |
| 1365 | MSKGEELFTGVVPILV ELDGDVNGHKFSVSGE GEGDATYGKLTLKFIC TTGKLPVPWPTLVTTF SYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQER TIFFKDDGNYKTRAEV KFEGDTLVNRIELKGI DFKEDGNILGHKLEYN YNSHNVYIMADKQKNG IKVNFKIRHNIEDGSV QLADHYQQNTPIGDGP VLLPDNHYLSTQSALS KDPNEKRDHMVLLEFV TAAGITHGMDELYK | GFP | Fluorescent protein | Vertical Franz diffusion cell | Cumulative amounts 24.15 ± 7.28 µg/cm2 and fluxes 4.02 ± 1.21 µg/cm2·h for stratum corneum. The receiver compartment of Franz Diffusion Cells had cumulative amount=22.61 ± 2.87 µg/cm2 and fluxes= 3.77 ± 0.48 µg/cm2·h | Stratum corneum of the abdominal skin of Sparague-Dawley rats after shaving off hair | 20891012 |
| 1366 | GRKKRRQRRRPPQRKC MSKGEELFTGVVPILV ELDGDVNGHKFSVSGE GEGDATYGKLTLKFIC TTGKLPVPWPTLVTTF SYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQE RTIFFKDDGNYKTRAE VKFEGDTLVNRIELKG IDFKEDGNILGHKLEY NYNSHNVYIMADKQKN GIKVNFKIRHNIEDGS VQLADHYQQNTPIGDG PVLLPDNHYLSTQSAL SKDPNEKRDHMVLLEF | N-terminal Tat fusion green fluorescent protein (GFP) (TG) | Fluorescent CPP | Vertical Franz diffusion cell | Cumulative amounts 6.06 ± 0.70 µg/cm2 and fluxes 1.01 ± 0.70 µg/cm2·h for viable epidermis and dermis of skin. | Viable epidermis and dermis of the abdominal skin of Sparague-Dawley rats after shaving off hair | 20891012 |
| 1367 | MSKGEELFTGVVPILV ELDGDVNGHKFSVSGE GEGDATYGKLTLKFIC TTGKLPVPWPTLVTTF SYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQER TIFFKDDGNYKTRAEV KFEGDTLVNRIELKGI DFKEDGNILGHKLEYN YNSHNVYIMADKQKNG IKVNFKIRHNIEDGSV QLADHYQQNTPIGDGP VLLPDNHYLSTQSALS KDPNEKRDHMVLLEFV TAAGITHGMDELYK | GFP | Fluorescent protein | Vertical Franz diffusion cell | Cumulative amounts 17.92 ± 0.78 µg/cm2 and fluxes 2.99 ± 0.26 µg/cm2·h for viable epidermis and dermis of skin. | Viable epidermis and dermis of the abdominal skin of Sparague-Dawley rats after shaving off hair | 20891012 |
| 1368 | GRKKRRQRRRPPQRKC MSKGEELFTGVVPILV ELDGDVNGHKFSVSGE GEGDATYGKLTLKFIC TTGKLPVPWPTLVTTF SYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQE RTIFFKDDGNYKTRAE VKFEGDTLVNRIELKG IDFKEDGNILGHKLEY NYNSHNVYIMADKQKN GIKVNFKIRHNIEDGS VQLADHYQQNTPIGDG PVLLPDNHYLSTQSAL SKDPNEKRDHMVLLEF | N-terminal Tat fusion green fluorescent protein (GFP) (TG) | Fluorescent CPP | Vertical Franz diffusion cell | Cumulative amounts 22.03 ± 4.01 µg/cm2 and fluxes 3.67 ± 2.33 µg/cm2·h for stratum corneum. The receiver compartment of Franz Diffusion Cells had cumulative amount=30.24 ± 4.81 µg/cm2 and fluxes= 5.04 ± 0.80 µg/cm2·h | Stratum corneum of the abdominal skin of Sparague-Dawley rats after shaving off hair | 20891012 |
| 1369 | GRKKRRQRRRPPQRKC MSKGEELFTGVVPILV ELDGDVNGHKFSVSGE GEGDATYGKLTLKFIC TTGKLPVPWPTLVTTF SYGVQCFSRYPDHMKQ HDFFKSAMPEGYVQE RTIFFKDDGNYKTRAE VKFEGDTLVNRIELKG IDFKEDGNILGHKLEY NYNSHNVYIMADKQKN GIKVNFKIRHNIEDGS VQLADHYQQNTPIGDG PVLLPDNHYLSTQSAL SKDPNEKRDHMVLLEF | N-terminal Tat fusion green fluorescent protein (GFP) (TG) | Fluorescent CPP | Vertical Franz diffusion cell | Cumulative amounts 8.59 ± 1.33 µg/cm2 and fluxes 1.43 ± 0.22 µg/cm2·h for stratum corneum. The receiver compartment of Franz Diffusion Cells had cumulative amount=62.75 ± 2.68 µg/cm2 and fluxes= 10.46 ± 3.45 µg/cm2·h | Stratum corneum of the abdominal skin of Sparague-Dawley rats after shaving off hair | 20891012 |
| 1377 | CDLPQTHSLGSRRTLM LLAQMRKISLFSCLKD RHDFGFPQEEFGNQFQ KAETIPVLHEMIQQIF NLFSTKDSSAAWDETL LDKFYTELYQQLNDLE ACVIQGVGVTETPLMK EDSILAVRKYFQRITL YLKEKKYSPCAWEVVR AEIMRSFSLSTNLQES LRSKE | Interferon Alpha (IFN α) | Antiviral, antiproliferative, and immunomodulatory properties | ELISA and antiviral assay | Antiviral assay showed an average IFN α levels of 380±60 IU/mg protein in skin homogenate. ELISA of skin homogenate increased the IFNα levels from <12.5pg/mg tissue to 122.4±25.9 pg/mg tissue. | Human skin biopsy samples | 21291377 |
| 1378 | CDLPQTHSLGSRRTLM LLAQMRKISLFSCLKD RHDFGFPQEEFGNQFQ KAETIPVLHEMIQQIF NLFSTKDSSAAWDETL LDKFYTELYQQLNDLE ACVIQGVGVTETPLMK EDSILAVRKYFQRITL YLKEKKYSPCAWEVVR AEIMRSFSLSTNLQES LRSKE | Interferon Alpha (IFN α) | Antiviral, antiproliferative, and immunomodulatory properties | ELISA and antiviral assay | Antiviral assay showed an average IFN α levels of 120±30 IU/mg protein in skin homogenate. ELISA of skin homogenate increased the IFNα levels from <12.5pg/mg tissue to 40.1±12.8 pg/mg tissue. | Human skin biopsy samples | 21291377 |
| 1379 | CDLPQTHSLGSRRTLM LLAQMRKISLFSCLKD RHDFGFPQEEFGNQFQ KAETIPVLHEMIQQIF NLFSTKDSSAAWDETL LDKFYTELYQQLNDLE ACVIQGVGVTETPLMK EDSILAVRKYFQRITL YLKEKKYSPCAWEVVR AEIMRSFSLSTNLQES LRSKE | Interferon Alpha (IFN α) | Antiviral, antiproliferative, and immunomodulatory properties | ELISA and antiviral assay | Antiviral assay showed an average IFN α levels of 400±80 IU/mg protein in skin homogenate. ELISA of skin homogenate increased the IFNα levels from <12.5pg/mg tissue to 107.5±18.1 pg/mg tissue. | Human skin biopsy samples | 21291377 |
| 1397 | Botulinum neurotoxin A light chain (PFVNKQF NYKDPVNGVDIAYIKIPN AGQMQPVKAFKIHNKI WVIPERDTFTNPEEGD LNPPPEAKQVPVSYY DSTYLSTDNEKDNYLK GVTKLFERIYSTDLGR MLLTSIVRGIPFWGG STIDTELKVIDTNCIN VIQPDGSYRSEE LNLVIIGPSADIIQFE CKSFGHEVLNLTRNGY GSTQYIRFSPDFT FGFEESLEVDTNPLL | Botulinum toxin type A | Potent inhibitor of cholinergic motor nerves. | Weights of the nasal secretion were collected and compared. | Topically applied botulinum toxin reduced neurally evoked rhinorrhea by an average of 41%. | Nasal cavity of male mongrel dogs | 7700663 |
| 1402 | (Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | Insulin | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | Chloride in the sweat determined by titration with a Cotiove chloridometer | Control/Cystic fibrosis patients: 14.81±2.39/79.70±3.59(Vehicle treated) and 14.47±2.66/68.07±3.29(Insulin treated) | Stratum corneum of arm of cystic fibrosis patients | 1144451 |
| 1403 | (Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | Insulin | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | Chloride in the sweat determined by titration with a Cotiove chloridometer | Control/Cystic fibrosis patients: 14.81±2.39/16.03±2.34(Vehicle treated) and 14.47±2.66/11.52±1.28(Insulin treated) | Stratum corneum of arm of cystic fibrosis patients | 1144451 |
| 1436 | ACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | α-CGRP (α-calcitonin gene-related peptide) | Specific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | Intraocular pressure (IOP) calculated electromanometrically, blood-aqueous barrier, pupil size, blood pressure and cyclic AMP (CAMP) content in the aqueous humour of rabbits via 125I-radioimmunoassay | IOP:Control=1.8mmHg, Neutral formaldehyde=From the baseline of 16.9±1.5 it rose by 27.3±3.8mmHg in 15.1±1.8 minutes, CGRP(0.5µg)=From the baseline of 18.5±1.1 it rose by 11.8±2.3mmHg in 15.0±2 minutes; Mean arterial blood pressure:Control=94±12/101±10(before), Formaldehyde=92±5/95±3(before), CGRP=94±5/98±4(before); cAMP after 30 minutes:Control=16.3±3.6pmol/ml, Formaldehyde right eye=88.5±35pmol/ml, Formaldehyde left e | Albino rabbits of both sexes weighing 2.2-3.1 kg were used. Right eye=Contralateral eye and left eye=Experimental. | 2842178 |
| 1437 | ACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | α-CGRP (α-calcitonin gene-related peptide) | Specific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | Intraocular pressure (IOP) calculated electromanometrically, blood-aqueous barrier, pupil size, blood pressure and cyclic AMP (CAMP) content in the aqueous humour of rabbits via 125I-radioimmunoassay | IOP:Control=1.8mmHg, Neutral formaldehyde=From the baseline of 16.9±1.5 it rose by 27.3±3.8mmHg in 15.1±1.8 minutes, CGRP(2.0µg)=From the baseline of 17.5±0.9 it rose by 19.3±3.6mmHg in 6.3±1.5 minutes; Mean arterial blood pressure:Control=94±12/101±10(before), Formaldehyde=92±5/95±3(before), CGRP=85±6/104±5(before); cAMP after 30 minutes:Control=16.3±3.6pmol/ml, Formaldehyde right eye=88.5±35pmol/ml, Formaldehyde left | Albino rabbits of both sexes weighing 2.2-3.1 kg were used. Right eye=Contralateral eye and left eye=Experimental. | 2842178 |
| 1438 | ACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | α-CGRP (α-calcitonin gene-related peptide) | Specific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | Radio-actively labelled microspheres were used to determine blood flow | Regional blood flow in anterior uvea(iris+ciliary body): For CGRP it rose by 244.8±80.2mg/minute/whole tissue, For saline it rose by 33.8±16.2mg/minute/whole tissue | Eyes of New Zealand albino rabbits | 3262039 |
| 1439 | ACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | α-CGRP (α-calcitonin gene-related peptide) | Specific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | Radio-actively labelled microspheres were used to determine blood flow | Regional blood flow in anterior uvea(iris+ciliary body): For CGRP it rose by 244.8±80.2mg/minute/whole tissue, For saline it rose by 33.8±16.2mg/minute/whole tissue, For methysergide it rose by 54.1±23.3mg/minute/whole tissue | Eyes of New Zealand albino rabbits | 3262039 |
| 1440 | ACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | α-CGRP (α-calcitonin gene-related peptide) | Specific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | Lowry method for protein estimation, cAMP content via 125I-radioimmunoassay, Electromanometrical recording intraocular pressure | Protein=23.7±2.3mg/ml, cAMP=243.2±37.9pmol/ml, Intraocular pressure=22mmHg at 5 min, 28mmHg at 10 min, 37mmHg at 15 min, 38mmHg at 28 min, 35mmHg at 30 minutes. | Eyes of New Zealand albino rabbits | 3262039 |
| 1441 | ACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | α-CGRP (α-calcitonin gene-related peptide) | Specific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | Lowry method for protein estimation, cAMP content via 125I-radioimmunoassay, Electromanometrical recording intraocular pressure | Protein=13.3±6.2mg/ml, cAMP=147.0±7.4pmol/ml, Intraocular pressure=19mmHg at 5 min, 21mmHg at 10 min, 26mmHg at 15 min, 31mmHg at 28 min, 35.5mmHg at 30 minutes. | Eyes of New Zealand albino rabbits | 3262039 |
| 1442 | ACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | α-CGRP (α-calcitonin gene-related peptide) | Specific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | Lowry method for protein estimation, cAMP content via 125I-radioimmunoassay, Electromanometrical recording intraocular pressure | Protein=0.6±0.04mg/ml, cAMP=34.6±3.1pmol/ml, Intraocular pressure=18mmHg at 5 min, 17mmHg at 10 min, 16.1mmHg at 15 min, 15.9mmHg at 28 min, 15.5mmHg at 30 minutes. | Eyes of New Zealand albino rabbits | 3262039 |
| 1443 | ACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | α-CGRP (α-calcitonin gene-related peptide) | Specific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | Lowry method for protein estimation, cAMP content via 125I-radioimmunoassay, Electromanometrical recording intraocular pressure | Protein=0.6±0.1mg/ml, cAMP=65.3±14.7pmol/ml, Intraocular pressure=14.5mmHg at 5 min, 13mmHg at 10 min, 12.8mmHg at 15 min, 12.5mmHg at 28 min, 13.1mmHg at 30 minutes. | Eyes of New Zealand albino rabbits | 3262039 |
| 1515 | SSSHPIFHRGEFSVCD SVSVWVGDKTTATDIK GKEVMVLGEVNINNSV FKQYFFETKCRDPNPV DSGCRGIDSKHWNSYC TTTHTFVKALTMDGKQ AAWRFIRIDTACVCVL SRKAVRRA | Nerve Growth Factor | Neurotrophic and immunomodulatory mediator responsible for the growth, differentiation, and survival of sensory neurons and acceleration of wound healing | Immunostaining | The average subbasal tubulin positive nerve bundle area in controls was 0.85. Treatment with NGF produced significant differences with respect to the control (P < 0.05). | Rabbit eye | 16123410 |
| 1526 | ALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | Flagellin | Topical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | Fungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Clinical score: Flagellin treated-2/PBS-6.2, Fungal clearance: Flagellin-3/PBS-0.5CFU(1000) of C. albicans per cornea, Reduced cytokine production and PMN infiltration= MIP-2:Flagellin-0/PBS-75pg/µg protein; ELISA:Flagellin has less content of the protein under study than present in PBS; MPO activity per cornea: Flagellin has less activity as compared to PBS control. | Eyes of wild type C57BL6 mice | 21310913 |
| 1527 | ALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | Flagellin | Topical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | Fungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Clinical score: Flagellin treated-1-2/PBS-6-7, Fungal clearance: Flagellin-0/PBS-1.7CFU(1000) of C. albicans per cornea, Reduced cytokine production and PMN infiltration= MIP-2:Flagellin-0/PBS-5pg/µg protein; ELISA:Flagellin has less content of the protein under study than present in PBS; MPO activity per cornea: Flagellin has almost negligible activity as compared to PBS control. | Eyes of wild type C57BL6 mice | 21310913 |
| 1528 | ALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | Flagellin | Topical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | Fungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Clinical score: Flagellin treated- ~0/PBS-5.8 | Eyes of wild type C57BL6 mice | 21310913 |
| 1529 | ALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | Flagellin | Topical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | Fungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Fungal clearance: Flagellin-2/PBS-6CFU(1000) of C. albicans per cornea, Reduced cytokine production and PMN infiltration= MIP-2:Flagellin-9.5/PBS-7pg/µg protein; ELISA:Flagellin has more content of the protein under study than present in PBS; MPO activity per cornea: Flagellin has more activity as compared to PBS control. | Eyes of wild type C57BL6 mice | 21310913 |
| 1530 | ALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | Flagellin | Topical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | Fungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Clinical score of Flagellin is slightly more than PBS control, both approximating to 9.1 and 8.9 respectively. | Eyes of TLR5-/- mouse breeding pairs | 21310913 |
| 1531 | ALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | Flagellin | Topical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | Fungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Clinical score: Flagellin-11.1/PBS-10.9; CFU(1000) of C. albicans per cornea-Flagellin-3.4/PBS-4.2; MPO activity per cornea: Flagellin-23/PBS-19. | Eyes of TLR5-/- mouse breeding pairs | 21310913 |
| 1532 | ALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | Flagellin | Topical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | Fungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Camp-/- mouse corneas were more susceptible than the wild type to C. albicans. Mean clinical scores after infection with 1.0*104 CFU of C. albicans are: Wild type-5.3, KO-9.4 | Eyes of Camp-/- [CRAMP-deficient] mouse breeding pairs on a B6 background | 21310913 |
| 1533 | ALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | Flagellin | Topical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | Fungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Camp-/- mouse corneas were more susceptible than the wild type to C. albicans. Mean clinical scores after infection with 1.0*104 CFU of C. albicans are: Wild type-5.8, KO-11.6 | Eyes of Camp-/- [CRAMP-deficient] mouse breeding pairs on a B6 background | 21310913 |
| 1534 | ALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | Flagellin | Topical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | Fungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Camp-/- mouse corneas were more susceptible than the wild type to C. albicans. Mean clinical scores after infection with 1.0*104 CFU of C. albicans are: Wild type-2.9, KO-11.8 | Eyes of Camp-/- [CRAMP-deficient] mouse breeding pairs on a B6 background | 21310913 |
| 1535 | ALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | Flagellin | Topical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | Fungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Camp-/- mouse corneas were more susceptible than the wild type to C. albicans. Mean clinical scores after infection with 1.0*105 CFU of C. albicans are: Wild type-8.7, KO-9.8 | Eyes of Camp-/- [CRAMP-deficient] mouse breeding pairs on a B6 background | 21310913 |
| 1536 | ALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | Flagellin | Topical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | Fungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Camp-/- mouse corneas were more susceptible than the wild type to C. albicans. Mean clinical scores after infection with 1.0*105 CFU of C. albicans are: Wild type-9.3, KO-12 | Eyes of Camp-/- [CRAMP-deficient] mouse breeding pairs on a B6 background | 21310913 |
| 1537 | ALTVNTNIASLNTQRNLNNS SASLNTSLQRLSTGSRINSAKD DAAGLQIANRLTSQVNGL NVATKNANDGISLAQT AEGALQQSTNILQRMRDL SLQSANGSNSDSERTALN GEVKQLQKELDRISNTTTFGG RKLLDGSFGVASFQVG SAANEIISVGIDEMSAES LNGTYFKADGGGAVTAAT ASGTVDIAIGITGGSAVNV KVDMKGNETAEQAA AKIAAAVNDANVGI GAFSDGDTISY | Flagellin | Topical flagellin enhanced innate immunity and protected injured corneas from C. albicans keratitis in a TLR5-dependent manner | Fungal load determination, Myeloperoxidase(MPO) determination and Cytokine ELISA measurement | Camp-/- mouse corneas were more susceptible than the wild type to C. albicans. Mean clinical scores after infection with 1.0*105 CFU of C. albicans are: Wild type-9.1, KO-11.9 | Eyes of Camp-/- [CRAMP-deficient] mouse breeding pairs on a B6 background | 21310913 |
| 1538 | QNPASPPEEGSPDPDSTGA LVEEEDPFFKVPVNKLA AAVSNFGYDLYRVRSSTS PTTNVLLSPLSVATAL SALSLGAEQRTESIIHR ALYYDLISSPDIHGTYKEL LDTVTAPQKNLKSAS RIVFEKKLRIKSSFVAPLE KSYGTRPRVLTGNP RLDLQEINNWVQAQ MKGKLARSTKEIPDEIS ILLLGVAHFKGQWVTKF DSRKTSLEDFYLDEER TVRVPMMSDPKAVLR YGLDSD | PEDF (Pigment epithelium-derived factor) | It induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. | VEGF and 8-OHdG Immunostaining, Measurement of corneal neo-vascularization via avidin-biotin-alkaline phosphatase kit and statistical analysis | Neo-vascularized area= 2% due to PEDF (PBS=3%) | Seven week-old male Spraque–Dawley rat's right eye was used as test and left eye considered as control (PBS) | 22386653 |
| 1539 | QNPASPPEEGSPDPDSTGA LVEEEDPFFKVPVNKLA AAVSNFGYDLYRVRSSTS PTTNVLLSPLSVATAL SALSLGAEQRTESIIHR ALYYDLISSPDIHGTYKEL LDTVTAPQKNLKSAS RIVFEKKLRIKSSFVAPLE KSYGTRPRVLTGNP RLDLQEINNWVQAQ MKGKLARSTKEIPDEIS ILLLGVAHFKGQWVTKF DSRKTSLEDFYLDEER TVRVPMMSDPKAVLR YGLDSD | PEDF (Pigment epithelium-derived factor) | It induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. | VEGF and 8-OHdG Immunostaining, Measurement of corneal neo-vascularization via avidin-biotin-alkaline phosphatase kit and statistical analysis | Neo-vascularized area= 9% due to PEDF (PBS=10%) | Seven week-old male Spraque–Dawley rat's right eye was used as test and left eye considered as control (PBS) | 22386653 |
| 1540 | QNPASPPEEGSPDPDSTGA LVEEEDPFFKVPVNKLA AAVSNFGYDLYRVRSSTS PTTNVLLSPLSVATAL SALSLGAEQRTESIIHR ALYYDLISSPDIHGTYKEL LDTVTAPQKNLKSAS RIVFEKKLRIKSSFVAPLE KSYGTRPRVLTGNP RLDLQEINNWVQAQ MKGKLARSTKEIPDEIS ILLLGVAHFKGQWVTKF DSRKTSLEDFYLDEER TVRVPMMSDPKAVLR YGLDSD | PEDF (Pigment epithelium-derived factor) | It induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. | VEGF and 8-OHdG Immunostaining, Measurement of corneal neo-vascularization via avidin-biotin-alkaline phosphatase kit and statistical analysis | Neo-vascularized area= 18% due to PEDF (PBS=20%) | Seven week-old male Spraque–Dawley rat's right eye was used as test and left eye considered as control (PBS) | 22386653 |
| 1541 | QNPASPPEEGSPDPDSTGA LVEEEDPFFKVPVNKLA AAVSNFGYDLYRVRSSTS PTTNVLLSPLSVATAL SALSLGAEQRTESIIHR ALYYDLISSPDIHGTYKEL LDTVTAPQKNLKSAS RIVFEKKLRIKSSFVAPLE KSYGTRPRVLTGNP RLDLQEINNWVQAQ MKGKLARSTKEIPDEIS ILLLGVAHFKGQWVTKF DSRKTSLEDFYLDEER TVRVPMMSDPKAVLR YGLDSD | PEDF (Pigment epithelium-derived factor) | It induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. | VEGF and 8-OHdG Immunostaining, Measurement of corneal neo-vascularization via avidin-biotin-alkaline phosphatase kit and statistical analysis | Neo-vascularized area= 22% due to PEDF (PBS=31%) or 65% of PBS on day 7(Control=4% of PBS); Oxidative stress generation, 8-OHdG level=75% of PBS (Control=50% of PBS); VEGF expression, VEGF level=71% of PBS (Control=40% of PBS) | Seven week-old male Spraque–Dawley rat's right eye was used as test and left eye considered as control (PBS) | 22386653 |
| 1614 | LLGDFFRKSKEKIGK EFKRIVQRIKDFLRN LVPRTES | LL-37 | Not mentioned | Statistical analysis was done in order to measure the efficacy of LL-37 as a drug. | The ulcers reduced to 32% | Human skin | 25041740 |
| 1615 | LLGDFFRKSKEKIGK EFKRIVQRIKDFLRN LVPRTES | LL-37 | Not mentioned | Statistical analysis was done in order to measure the efficacy of LL-37 as a drug. | The ulcers decreased to 50% | Human skin | 25041740 |