Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_0558	Histoplasma strain 505 yeast cells Click for more detail	Histoplasma strain 506 (others)	NA	NA	Whole organism	Natural	The binding leads to the secretion of cytokines such as TNF-‚ç∫ and IL-6, via syk dependent pathway	Dectin-1	C type Lectin (CTL/CLR)	Mice (Murine)	Macropahges	lectin binding domain	Q6QLQ4.fasta	Q6QLQ4	244	It is was responsible for cytokine response.	ELISA	20360401	2010	Pubchem Assay
PRRID_0558	Histoplasma strain 505 yeast cells Click for more detail	Histoplasma strain 506 (others)	NA	NA	Whole organism	Natural	The binding leads to the secretion of cytokines such as TNF-‚ç∫ and IL-6, via syk dependent pathway	Dectin-1	C type Lectin (CTL/CLR)	Mice (Murine)	Macropahges	lectin binding domain	Q6QLQ4.fasta	Q6QLQ4	244	It is was responsible for cytokine response.	ELISA	20360401	2010	Pubchem Assay
PRRID_0559	HMGB1 Click for more detail	Mouse model of endotoxemia	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	215	Protein	Natural	Acts as a mediator of inflammation and organ damage	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	NA	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	Acts as a mediator of inflammation and organ damage	NA	20740341	2010	Pubchem Assay
PRRID_0559	HMGB1 Click for more detail	Mouse model of endotoxemia	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	215	Protein	Natural	Acts as a mediator of inflammation and organ damage	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	NA	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	Acts as a mediator of inflammation and organ damage	NA	20740341	2010	Pubchem Assay
PRRID_0560	HMGB1 Click for more detail	Mouse model of endotoxemia	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	215	Protein	Natural	Acts as a mediator of inflammation and organ damage	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	NA	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	Acts as a mediator of inflammation and organ damage	NA	20740341	2010	Pubchem Assay
PRRID_0560	HMGB1 Click for more detail	Mouse model of endotoxemia	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	215	Protein	Natural	Acts as a mediator of inflammation and organ damage	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	NA	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	Acts as a mediator of inflammation and organ damage	NA	20740341	2010	Pubchem Assay
PRRID_0561	HMGB1 Click for more detail	Mouse model of endotoxemia	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	215	Protein	Natural	Acts as a mediator of inflammation and organ damage	RAGE	Receptor for advanced glycation endproducts (RAGE)	Mice	NA	Leucine-rich Repeat (LRR) Domain	Q62151.fasta	Q62151	402	Acts as a mediator of inflammation and organ damage	NA	20740341	2010	Pubchem Assay
PRRID_0561	HMGB1 Click for more detail	Mouse model of endotoxemia	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	215	Protein	Natural	Acts as a mediator of inflammation and organ damage	RAGE	Receptor for advanced glycation endproducts (RAGE)	Mice	NA	Leucine-rich Repeat (LRR) Domain	Q62151.fasta	Q62151	402	Acts as a mediator of inflammation and organ damage	NA	20740341	2010	Pubchem Assay
PRRID_0563	HMGB1 Click for more detail	Host (Endogenous) (others)	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	215	Protein	Natural	Epinephrine directly acts through MœÜ Œ≤- adrenergic receptor to stimulate HMGB1 secretion from the MœÜ in an autocrine manner	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	lung	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20706658	2010	Pubchem Assay
PRRID_0563	HMGB1 Click for more detail	Host (Endogenous) (others)	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	215	Protein	Natural	Epinephrine directly acts through MœÜ Œ≤- adrenergic receptor to stimulate HMGB1 secretion from the MœÜ in an autocrine manner	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	lung	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20706658	2010	Pubchem Assay
PRRID_0567	HSP72 Click for more detail	Host (Endogenous) (others)	NA	NA	Protein	Natural	increases in MIP-2 release	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	hepatocytes	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20689929	2010	Pubchem Assay
PRRID_0567	HSP72 Click for more detail	Host (Endogenous) (others)	NA	NA	Protein	Natural	increases in MIP-2 release	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	hepatocytes	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20689929	2010	Pubchem Assay
PRRID_0569	Hyaluronan Click for more detail	Prepared by HCL degradation (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Carbohydrate	Synthetic	Its binding leads to the production of interleukin-10, and down-regulated chemokine production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	MRL-lpr/lpr Mice	Large intestinal epithelial cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It modulates Th-1-type autoimmune disease and inflammation by up-regulating SOCS3 expression and down-regulating pleiotrophin expression via TLR-4 in intestinal epithelial cells and hence promotes the survival.	Array Analysis	20504769	2010	Pubchem Assay
PRRID_0569	Hyaluronan Click for more detail	Prepared by HCL degradation (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Carbohydrate	Synthetic	Its binding leads to the production of interleukin-10, and down-regulated chemokine production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	MRL-lpr/lpr Mice	Large intestinal epithelial cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It modulates Th-1-type autoimmune disease and inflammation by up-regulating SOCS3 expression and down-regulating pleiotrophin expression via TLR-4 in intestinal epithelial cells and hence promotes the survival.	Array Analysis	20504769	2010	Pubchem Assay
PRRID_0570	Hyaluronic acid Click for more detail	Host (Endogenous) (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Glycosaminoglycan	Natural	Interaction between lower molecular weight HA and TLR leads to decrease in CD44-dependent clearance of HA leads to enhanced lung inflammation and injury	Toll-like receptor 2 (TLR2)/Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Macropahges	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It leads to the production of inflammatory chemokines and cytokines	NA	20689929	2010	NA
PRRID_0570	Hyaluronic acid Click for more detail	Host (Endogenous) (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Glycosaminoglycan	Natural	Interaction between lower molecular weight HA and TLR leads to decrease in CD44-dependent clearance of HA leads to enhanced lung inflammation and injury	Toll-like receptor 2 (TLR2)/Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Macropahges	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It leads to the production of inflammatory chemokines and cytokines	NA	20689929	2010	NA
PRRID_0571	hypomethylated DNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	release of proinflammatory cytokines and Pathgen Clearance	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It has the role in the inflammation.	NA	20739362	2010	Pubchem Assay
PRRID_0571	hypomethylated DNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	release of proinflammatory cytokines and Pathgen Clearance	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It has the role in the inflammation.	NA	20739362	2010	Pubchem Assay
PRRID_0574	Imiquimod Click for more detail	imidazoquinoline (others)	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	It induces inflammatory responses when applied to the skin	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	NA	Leucine-rich Repeat (LRR) Domain	P58681.fasta	P58681	1050	It leads to the inflammation of the cell	NA	20739947	2010	Pubchem Assay
PRRID_0574	Imiquimod Click for more detail	imidazoquinoline (others)	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	It induces inflammatory responses when applied to the skin	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	NA	Leucine-rich Repeat (LRR) Domain	P58681.fasta	P58681	1050	It leads to the inflammation of the cell	NA	20739947	2010	Pubchem Assay
PRRID_0577	Imiquimod Click for more detail	imidazoquinoline (others)	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	imidazoquinolines	Synthetic	It activates the NF-	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice (Murine)	Spleenocytes	Leucine-rich Repeat (LRR) Domain	P58681.fasta	P58681	1050	It leads to the activation of splenocytes and the inhibition of murine B16 melanoma growth and metastasis	NA	20543857	2010	Pubchem Assay
PRRID_0577	Imiquimod Click for more detail	imidazoquinoline (others)	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	imidazoquinolines	Synthetic	It activates the NF-	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice (Murine)	Spleenocytes	Leucine-rich Repeat (LRR) Domain	P58681.fasta	P58681	1050	It leads to the activation of splenocytes and the inhibition of murine B16 melanoma growth and metastasis	NA	20543857	2010	Pubchem Assay
PRRID_0580	IMO-1 Click for more detail	NA	5'-TCTGToCG2TTGT-X-TGTTG2CoTGTCT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-1	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0580	IMO-1 Click for more detail	NA	5'-TCTGToCG2TTGT-X-TGTTG2CoTGTCT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-1	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0581	IMO-10 Click for more detail	NA	5'-TCG2TCG2TTdUY-M-YdUTTG2CTG2CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-10	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0581	IMO-10 Click for more detail	NA	5'-TCG2TCG2TTdUY-M-YdUTTG2CTG2CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-10	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0582	IMO-11 Click for more detail	NA	5'-TCG1TACG1TACG1-X-G1CATG1CATG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-11	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0582	IMO-11 Click for more detail	NA	5'-TCG1TACG1TACG1-X-G1CATG1CATG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-11	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0583	IMO-12 Click for more detail	NA	5'-TCG1AACG1TTCoG-Z-GoCTTG1CAAG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-12	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0583	IMO-12 Click for more detail	NA	5'-TCG1AACG1TTCoG-Z-GoCTTG1CAAG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-12	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0584	IMO-13 Click for more detail	NA	5'-TCG1AACG1TTCG1-L-G1CTTG1CAAG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-13	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0584	IMO-13 Click for more detail	NA	5'-TCG1AACG1TTCG1-L-G1CTTG1CAAG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-13	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0585	IMO-14 Click for more detail	NA	5'-TCG1AACG1ToTCoG-m-GoCToTG1CAAG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-14	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0585	IMO-14 Click for more detail	NA	5'-TCG1AACG1ToTCoG-m-GoCToTG1CAAG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-14	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0586	IMO-15 Click for more detail	NA	5'-TCG1AACG1dUdUCoG-M-GoCdUdUG1CAAG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-15	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0586	IMO-15 Click for more detail	NA	5'-TCG1AACG1dUdUCoG-M-GoCdUdUG1CAAG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-15	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0587	IMO-16 Click for more detail	NA	5'-ACACACCAACT-X-TCAACCACACA-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-16	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0587	IMO-16 Click for more detail	NA	5'-ACACACCAACT-X-TCAACCACACA-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-16	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0588	IMO-2 Click for more detail	NA	5'-TCTGTCG2TTCU-X-UCTTG2CTGTCT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-2	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0588	IMO-2 Click for more detail	NA	5'-TCTGTCG2TTCU-X-UCTTG2CTGTCT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-2	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0589	IMO-3 Click for more detail	NA	5'-TCAGToCG2TTAC-Z-CATTG2CoTGACT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-3	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0589	IMO-3 Click for more detail	NA	5'-TCAGToCG2TTAC-Z-CATTG2CoTGACT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-3	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0590	IMO-4 Click for more detail	NA	5'-TCTGoToCG2TTAG-M-GATTG2CoToGTCT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-4	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0590	IMO-4 Click for more detail	NA	5'-TCTGoToCG2TTAG-M-GATTG2CoToGTCT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-4	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0591	IMO-5 Click for more detail	NA	5'-CAGTCoG2TTCAG-Z-GACTTG2oCTGAC-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-5	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0591	IMO-5 Click for more detail	NA	5'-CAGTCoG2TTCAG-Z-GACTTG2oCTGAC-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-5	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0592	IMO-6 Click for more detail	NA	5'-TCG1TCG1TTTY-M-YTTTG1CTG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-6	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0592	IMO-6 Click for more detail	NA	5'-TCG1TCG1TTTY-M-YTTTG1CTG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-6	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0593	IMO-7 Click for more detail	NA	5'-TCG1TCG1TTTY-X-YTTTG1CTG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-7	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0593	IMO-7 Click for more detail	NA	5'-TCG1TCG1TTTY-X-YTTTG1CTG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-7	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0594	IMO-8 Click for more detail	NA	5'-TCG1TCG1TTTUU-X-UUTTTG1CTG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-8	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0594	IMO-8 Click for more detail	NA	5'-TCG1TCG1TTTUU-X-UUTTTG1CTG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-8	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0595	IMO-9 Click for more detail	NA	5'-TCG1TCG1TTdUY-Z-YdUTTG1CTG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-9	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0595	IMO-9 Click for more detail	NA	5'-TCG1TCG1TTdUY-Z-YdUTTG1CTG1CT-5'	NA	Nucleic Acid	Synthetic	Binding leads to the secretion of cytokines and chemokines such as IL-6, IP-10, IL-12 and MCP-9	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	HEK293 cells, Bcells, PDCs, mDCs, PBMC	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	This has immunostimulatory effect	Cytokines assay	20381019	2010	Pubchem Assay
PRRID_0599	Korean mistletoe lectin (KML-C) Click for more detail	Korean mistletoe (Viscum album coloratum) (plant)	NA	NA	Lectin	Natural	Binding leads to the upregulation of interleukin-1 receptor-associated kinase-1 (IRAK1), resulting in macrophage activation and TNF-a production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Macropahges	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	KML-C has strong immunomodulatory effects, such as immune cell activation and cytokine induction, which results in antitumor activities or protection from microbial infections.	ELISA	20450885	2010	Pubchem Assay
PRRID_0599	Korean mistletoe lectin (KML-C) Click for more detail	Korean mistletoe (Viscum album coloratum) (plant)	NA	NA	Lectin	Natural	Binding leads to the upregulation of interleukin-1 receptor-associated kinase-1 (IRAK1), resulting in macrophage activation and TNF-a production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Macropahges	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	KML-C has strong immunomodulatory effects, such as immune cell activation and cytokine induction, which results in antitumor activities or protection from microbial infections.	ELISA	20450885	2010	Pubchem Assay
PRRID_0601	LAM Click for more detail	Mycobacteria (Bacteria)	OC[C@H]1O[C@@H](S[C@H]2[C@H](O)[C@@H](CO)O[C@@H](O[C@@H]3[C@H](O)[C@@H](CO)O[C@H](Oc4ccc(cc4)[N+]([O-])=O)[C@@H]3O)[C@@H]2O)[C@H](O)[C@@H](O)[C@@H]1O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-Œ± and induces augment PMN migration.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0601	LAM Click for more detail	Mycobacteria (Bacteria)	OC[C@H]1O[C@@H](S[C@H]2[C@H](O)[C@@H](CO)O[C@@H](O[C@@H]3[C@H](O)[C@@H](CO)O[C@H](Oc4ccc(cc4)[N+]([O-])=O)[C@@H]3O)[C@@H]2O)[C@H](O)[C@@H](O)[C@@H]1O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-Œ± and induces augment PMN migration.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0602	lentinan Click for more detail	Lentinus edodes (fungi)	C(C1C(C(C(C(O1)OCC2C(C(C(C(O2)O)O)OC3C(C(C(C(O3)CO)O)OC4C(C(C(C(O4)CO)O)OC5C(C(C(C(O5)COC6C(C(C(C(O6)CO)O)O)O)O)OC7C(C(C(C(O7)CO)O)O)O)O)O)O)O)O)O)O)O	NA	Biological response modifiers (BRMs)	Natural	Medicinal properties	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	used clinically for cancer therapy	NA	20699131	2010	Pubchem Assay
PRRID_0602	lentinan Click for more detail	Lentinus edodes (fungi)	C(C1C(C(C(C(O1)OCC2C(C(C(C(O2)O)O)OC3C(C(C(C(O3)CO)O)OC4C(C(C(C(O4)CO)O)OC5C(C(C(C(O5)COC6C(C(C(C(O6)CO)O)O)O)O)OC7C(C(C(C(O7)CO)O)O)O)O)O)O)O)O)O)O)O	NA	Biological response modifiers (BRMs)	Natural	Medicinal properties	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	used clinically for cancer therapy	NA	20699131	2010	Pubchem Assay
PRRID_0603	lethal toxin (LeTx) Click for more detail	Bacillus anthracis(Bacteria)	NA	NA	toxin	Natural	It‚Äôs binding to the IPAF leads to the activation of caspase-1 via ASC adaptor protein	Nod-like receptor protein 1 (NLRP1)	NOD-like receptor (NLR)	Mice	Macropahges	NA	Q2LKU9.fasta	Q2LKU9	1182	It activates the inflammasome via NLRP1	NA	20303873	2010	Pubchem Assay
PRRID_0603	lethal toxin (LeTx) Click for more detail	Bacillus anthracis(Bacteria)	NA	NA	toxin	Natural	It‚Äôs binding to the IPAF leads to the activation of caspase-1 via ASC adaptor protein	Nod-like receptor protein 1 (NLRP1)	NOD-like receptor (NLR)	Mice	Macropahges	NA	Q2LKU9.fasta	Q2LKU9	1182	It activates the inflammasome via NLRP1	NA	20303873	2010	Pubchem Assay
PRRID_0608	Lipopolysaccharide (LPS) Click for more detail	Bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	K63-linked ubiquitination of Beclin1 using TRAF6 and A20 and triggered autophagy	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Plasma Membrane	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It leads to autophagy and hence clearance of the pathogen	NA	20798608	2010	Pubchem Assay
PRRID_0608	Lipopolysaccharide (LPS) Click for more detail	Bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	K63-linked ubiquitination of Beclin1 using TRAF6 and A20 and triggered autophagy	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Plasma Membrane	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It leads to autophagy and hence clearance of the pathogen	NA	20798608	2010	Pubchem Assay
PRRID_0614	Lipopolysaccharide (LPS) Click for more detail	S. aureus (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Lipopolysaccharides are the potent activators of TLR4	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	C57BL/6 Mice	Macropahges	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	Contributes to inflammatory responses induced by orthopaedic wear particles in cell culture and murine models of aseptic loosening of orthopaedic implants	NA	20729214	2010	Pubchem Assay
PRRID_0614	Lipopolysaccharide (LPS) Click for more detail	S. aureus (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Lipopolysaccharides are the potent activators of TLR4	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	C57BL/6 Mice	Macropahges	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	Contributes to inflammatory responses induced by orthopaedic wear particles in cell culture and murine models of aseptic loosening of orthopaedic implants	NA	20729214	2010	Pubchem Assay
PRRID_0616	Lipopolysaccharide (LPS) Click for more detail	Escherichia coli O111: B4 (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	BCAP-L is a negative regulator of TLR signaling-induced production of IL-6 and IL10 but not TNF-a in macrophages	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It has the role in the inflammation.	NA	20728433	2010	Pubchem Assay
PRRID_0616	Lipopolysaccharide (LPS) Click for more detail	Escherichia coli O111: B4 (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	BCAP-L is a negative regulator of TLR signaling-induced production of IL-6 and IL10 but not TNF-a in macrophages	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It has the role in the inflammation.	NA	20728433	2010	Pubchem Assay
PRRID_0621	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	induces a signaling cascade that utilizes both the MyD88- and TRIF-dependent pathways, leading to NF-kB and IRF3/7 activation	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It has the role in the inflammation.	NA	20713100	2010	Pubchem Assay
PRRID_0621	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	induces a signaling cascade that utilizes both the MyD88- and TRIF-dependent pathways, leading to NF-kB and IRF3/7 activation	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It has the role in the inflammation.	NA	20713100	2010	Pubchem Assay
PRRID_0624	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	It produces a large amount of glutamate, an important neurotransmitter but also a potent neurotoxin and is linked to oligodendrocyte injury	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Microglia	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	produce a large amount of glutamate, an important neurotransmitter but also a potent neurotoxin and is linked to oligodendrocyte injury	NA	20706642	2010	Pubchem Assay
PRRID_0624	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	It produces a large amount of glutamate, an important neurotransmitter but also a potent neurotoxin and is linked to oligodendrocyte injury	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Microglia	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	produce a large amount of glutamate, an important neurotransmitter but also a potent neurotoxin and is linked to oligodendrocyte injury	NA	20706642	2010	Pubchem Assay
PRRID_0628	Lipopolysaccharide (LPS) Click for more detail	Bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	AD Mice's hippocampus	microglia	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	Involved in the clearance of AŒ≤ deposits in the brain	NA	20706642	2010	Pubchem Assay
PRRID_0628	Lipopolysaccharide (LPS) Click for more detail	Bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	AD Mice's hippocampus	microglia	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	Involved in the clearance of AŒ≤ deposits in the brain	NA	20706642	2010	Pubchem Assay
PRRID_0630	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	NA	I-ankyrin-repeats	ankyrin-repeats	Mice	small intestine, trachea, cornea, and conjunctiva, liver and kidney tissue	NA	NA	NA	NA	suppress the production of proinflammatory cytokines	NA	20703156	2010	NA
PRRID_0630	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	NA	I-ankyrin-repeats	ankyrin-repeats	Mice	small intestine, trachea, cornea, and conjunctiva, liver and kidney tissue	NA	NA	NA	NA	suppress the production of proinflammatory cytokines	NA	20703156	2010	NA
PRRID_0644	Lipopolysaccharide (LPS) Click for more detail	Escherichia coli strain 0111:B4 (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	It induces the release of microparticles by the macrophages	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Macropahes	LRR	Q9QUK6.fasta	Q9QUK6	835	It leads to the release of MPs which act as the novel signals for innate immunity	Griess assay	20335312	2010	Pubchem Assay
PRRID_0644	Lipopolysaccharide (LPS) Click for more detail	Escherichia coli strain 0111:B4 (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	It induces the release of microparticles by the macrophages	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Macropahes	LRR	Q9QUK6.fasta	Q9QUK6	835	It leads to the release of MPs which act as the novel signals for innate immunity	Griess assay	20335312	2010	Pubchem Assay
PRRID_0650	Peptidoglycan (PGN) Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Their binding to the TLR2 leads to the activation of the downstream signalling	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	C57/BL Mice cell line	NA	Leucine-rich Repeat (LRR) Domain	O53505.fasta	O53505	227	maturation of the Dendritic cells	NA	20795386	2010	Pubchem Assay
PRRID_0650	Peptidoglycan (PGN) Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Their binding to the TLR2 leads to the activation of the downstream signalling	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	C57/BL Mice cell line	NA	Leucine-rich Repeat (LRR) Domain	O53505.fasta	O53505	227	maturation of the Dendritic cells	NA	20795386	2010	Pubchem Assay
PRRID_0653	Lipoteichoic Acid (LTA) Click for more detail	E. coli(Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	Peptidoglycan is the potent activator of the TLR2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	C57BL/6 Mice	NA	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	Contributes to inflammatory responses induced by orthopaedic wear particles in cell culture and murine models of aseptic loosening of orthopaedic implants	NA	20729214	2010	Pubchem Assay
PRRID_0653	Lipoteichoic Acid (LTA) Click for more detail	E. coli(Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	Peptidoglycan is the potent activator of the TLR2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	C57BL/6 Mice	NA	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	Contributes to inflammatory responses induced by orthopaedic wear particles in cell culture and murine models of aseptic loosening of orthopaedic implants	NA	20729214	2010	Pubchem Assay
PRRID_0660	Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail	human umbilical cord (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Endogenous	Synthetic	Binding of the ligand leads to Akt phosphorylation and activation of the transcription factor NF-Œ∫B which results in secretion of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	embryonic mouse telencephalon and NPC	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	its activation inhibits NPC proliferation and decreases cell proliferation.	NA	20456021	2010	Pubchem Assay
PRRID_0660	Low Molecular Weight Hyaluronic Acid (LMW-HA) Click for more detail	human umbilical cord (others)	CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O	NA	Endogenous	Synthetic	Binding of the ligand leads to Akt phosphorylation and activation of the transcription factor NF-Œ∫B which results in secretion of proinflammatory cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	embryonic mouse telencephalon and NPC	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	its activation inhibits NPC proliferation and decreases cell proliferation.	NA	20456021	2010	Pubchem Assay
PRRID_0671	Mannan Click for more detail	Candida albicans(fungi)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Polysaccharides	Natural	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20713100	2010	Pubchem Assay
PRRID_0671	Mannan Click for more detail	Candida albicans(fungi)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Polysaccharides	Natural	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20713100	2010	Pubchem Assay
PRRID_0676	mannose, fucose and N-acetylglucosamine residues Click for more detail	Endogenous (others)	C(C1C(C(C(C(O1)O)O)O)O)O, CC(C(C(C(C=O)O)O)O)O, CC(=O)NC1C(C(C(OC1O)CO)O)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	These ligands binds to MR in calcium-dependent fashion, leads to the secretion of proinflammatory molecules, resulted in inflammation	Mannose receptor	Mannose receptor (MR)	Mice (Murine)	macrophages, certain dendritic cells, endothelial cell and mesangial cells	NA	Q61830.fasta	Q61830	1456	It helps in clearing endogenous ligands released in the inflammatory response including lysosomal hydrolases, tissue plasminogen activator and myeloperoxidase and also has tissue protection during inflammation	NA	20650906	2010	Pubchem Assay
PRRID_0676	mannose, fucose and N-acetylglucosamine residues Click for more detail	Endogenous (others)	C(C1C(C(C(C(O1)O)O)O)O)O, CC(C(C(C(C=O)O)O)O)O, CC(=O)NC1C(C(C(OC1O)CO)O)O	NA	Damage-associated molecular patterns (DAMPs)	Natural	These ligands binds to MR in calcium-dependent fashion, leads to the secretion of proinflammatory molecules, resulted in inflammation	Mannose receptor	Mannose receptor (MR)	Mice (Murine)	macrophages, certain dendritic cells, endothelial cell and mesangial cells	NA	Q61830.fasta	Q61830	1456	It helps in clearing endogenous ligands released in the inflammatory response including lysosomal hydrolases, tissue plasminogen activator and myeloperoxidase and also has tissue protection during inflammation	NA	20650906	2010	Pubchem Assay
PRRID_0684	MOMP Click for more detail	Shigella flexneri (Bacteria)	NA	NA	Protein	Natural	It stimulates macrophages, up regulates the surface expression of MHC-II and B7-1 and enhances the production of different cytokines (such as ILp70, TNF-‚ç∫, Il-6) and chemokines (like MIP-1‚ç∫, MIP-1Œ≤ and RANTES)	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Macropahes	LRR	Q9QUN7.fasta	Q9QUN7	784	It initiates event in the antibacterial host response.	ELISA	20347487	2010	Pubchem Assay
PRRID_0684	MOMP Click for more detail	Shigella flexneri (Bacteria)	NA	NA	Protein	Natural	It stimulates macrophages, up regulates the surface expression of MHC-II and B7-1 and enhances the production of different cytokines (such as ILp70, TNF-‚ç∫, Il-6) and chemokines (like MIP-1‚ç∫, MIP-1Œ≤ and RANTES)	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Macropahes	LRR	Q9QUN7.fasta	Q9QUN7	784	It initiates event in the antibacterial host response.	ELISA	20347487	2010	Pubchem Assay
PRRID_0689	Mrp14 Click for more detail	Mice (others)	MIENYWTSFCGNHHTSSNCTVRFLQICFGITLSFLTLCICLFHKEPPKRIHQFFCLRLVSALFNGIIGSLDLVLGIWVLRENHSKPLILWLVILIQGFTWLFINLIICVRGTRIRKSSLRLLSIFSFFYGLVSSCLSVNNAVFGDELAVRTILDVLLLPGSVLLLLSAYKGYRFDESGESSLYEPLNAGDSNGFSEKADFDNRVSQFAKAGLFSTLSFWWLNSLIKRGNVKDLEEDDIPELRKEERAETCYSLFEENLIEQKRRLGSSCQPSILKVTVLCVWRELLTSGFFAFMKIVAVSAGPLLLNAFILVAEGNASFRYEGLVLAVLLFFSKMIESLSQRQWYFRCRIVGLRVRSLLTAAINKKQLRLNNSSRLIHSGSEIMNYATVDAYRIGEFPYWFHQLWTTSFQLLIALGILFHSVGVATFSALAVIILTVLCNAPIAKLQNKFQSELMTSQDERLKACNESLVNMKVLKLYAWESHFKKVIEKLRNIELKSLKAVQMRKAYNAVLFWSSPVFVSAATFATCYFLDIPLRASNVFTFVATLRLVQDPVRMIPDVIGVTIQAKVAFSRIATFLEAPELQGGERRRKQRSEGNQNAIIIKSASFSWEEKGSTKPNLRNVRLEVKFGEKVAVCGEVGSGKSTLLAAILGETPCVSGTIDFYGTIAYVSQTAWIQTGTIRDNILFGGVMDEHRYRETIQKSSLDKDLELLPDGDQTEIGERGVNLSGGQKQRIQLARALYQDADIYLLDDPFSAVDAHTASSLFQEYVMDALAGKAVLLVTHQVDFLPAFDSVLLMSDGEITEADTYQELLARSRDFQDLVNAHRETAGSERVVAVENPTKPVKEINRVISSQSKVLKPSRLIKQEEREKGDTGLRPYIQYMNQNKGYIFFFIASLAQVTFAVGQILQNSWMAANVDNPQVSTLKLILVYLLIGLCSVLCLMVRSVCVVIMCMKSSASLFSQLLNSLFRAPMSFYDSTPLGRILSRVSSDLSIVDLDV	1453	Damage-associated molecular patterns (DAMPs)	Natural	Binding leads to the secretion of the IL-18	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Leukocytes and endothelial cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It promotes the inflammation and might be involved in the progression of inflammation during CD40L-induced autoimmunity. It is also crucial for the devlopment of CD8+ T cells	ELISA	20473308	2010	Pubchem Assay
PRRID_0689	Mrp14 Click for more detail	Mice (others)	MIENYWTSFCGNHHTSSNCTVRFLQICFGITLSFLTLCICLFHKEPPKRIHQFFCLRLVSALFNGIIGSLDLVLGIWVLRENHSKPLILWLVILIQGFTWLFINLIICVRGTRIRKSSLRLLSIFSFFYGLVSSCLSVNNAVFGDELAVRTILDVLLLPGSVLLLLSAYKGYRFDESGESSLYEPLNAGDSNGFSEKADFDNRVSQFAKAGLFSTLSFWWLNSLIKRGNVKDLEEDDIPELRKEERAETCYSLFEENLIEQKRRLGSSCQPSILKVTVLCVWRELLTSGFFAFMKIVAVSAGPLLLNAFILVAEGNASFRYEGLVLAVLLFFSKMIESLSQRQWYFRCRIVGLRVRSLLTAAINKKQLRLNNSSRLIHSGSEIMNYATVDAYRIGEFPYWFHQLWTTSFQLLIALGILFHSVGVATFSALAVIILTVLCNAPIAKLQNKFQSELMTSQDERLKACNESLVNMKVLKLYAWESHFKKVIEKLRNIELKSLKAVQMRKAYNAVLFWSSPVFVSAATFATCYFLDIPLRASNVFTFVATLRLVQDPVRMIPDVIGVTIQAKVAFSRIATFLEAPELQGGERRRKQRSEGNQNAIIIKSASFSWEEKGSTKPNLRNVRLEVKFGEKVAVCGEVGSGKSTLLAAILGETPCVSGTIDFYGTIAYVSQTAWIQTGTIRDNILFGGVMDEHRYRETIQKSSLDKDLELLPDGDQTEIGERGVNLSGGQKQRIQLARALYQDADIYLLDDPFSAVDAHTASSLFQEYVMDALAGKAVLLVTHQVDFLPAFDSVLLMSDGEITEADTYQELLARSRDFQDLVNAHRETAGSERVVAVENPTKPVKEINRVISSQSKVLKPSRLIKQEEREKGDTGLRPYIQYMNQNKGYIFFFIASLAQVTFAVGQILQNSWMAANVDNPQVSTLKLILVYLLIGLCSVLCLMVRSVCVVIMCMKSSASLFSQLLNSLFRAPMSFYDSTPLGRILSRVSSDLSIVDLDV	1453	Damage-associated molecular patterns (DAMPs)	Natural	Binding leads to the secretion of the IL-18	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Leukocytes and endothelial cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It promotes the inflammation and might be involved in the progression of inflammation during CD40L-induced autoimmunity. It is also crucial for the devlopment of CD8+ T cells	ELISA	20473308	2010	Pubchem Assay
PRRID_0690	Mrp8 Click for more detail	Mice (others)	MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE	89	Damage-associated molecular patterns (DAMPs)	Natural	Binding leads to the secretion of the IL-17	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Leukocytes and endothelial cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It promotes the inflammation and might be involved in the progression of inflammation during CD40L-induced autoimmunity. It is also crucial for the devlopment of CD8+ T cells	ELISA	20473308	2010	Pubchem Assay
PRRID_0690	Mrp8 Click for more detail	Mice (others)	MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE	89	Damage-associated molecular patterns (DAMPs)	Natural	Binding leads to the secretion of the IL-17	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Leukocytes and endothelial cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It promotes the inflammation and might be involved in the progression of inflammation during CD40L-induced autoimmunity. It is also crucial for the devlopment of CD8+ T cells	ELISA	20473308	2010	Pubchem Assay
PRRID_0691	MsST Click for more detail	Streptococcus thermophilus lacZ (Bacteria)	MNMTEKIQTYLNDPKIVSVNTVDAHSDHKYFESLEEFSEGEMKLRQSLNGKWKIHYAQNTNQVLKDFYKTEFDETDLNFINVPGHLELQGFGSPQYVNTQYPWDGKEFLRPPQVPQESNAVASYVKHFTLNDALKDKKVFISFQGVATSIFVWVNGNFVGYSEDSFTPSEFEISDYLVEGDNKLAVAVYRYSTASWLEDQDFWRLYGIFRDVYLYAIPKVHVQDLFVKGDYDYQTKAGQLDIDLKTVGDYEDKKIKYVLSDYEGIVTEGDASVNGDGELSVSLENLKIKPWSAESPKLYDLILHVLDDDQVVEVVPVKVGFRRFEIKDKLMLLNGKRIVFKGVNRHEFNARTGRCITEEDMLWDIKVMKQHNINAVRTSHYPNQTRWYELCDEYGLYVIDEANLETHGTWQKLGLCEPSWNIPASEPEWLPACLDRANNMFQRDKNHASVIIWSCGNESYAGKDIADMADYFRSVDNTRPVHYEGVAWCREFDYITDIESRMYAKPADIEEYLTTGKLVDLSSVSDKHFASGNLTNKPQKPYISCEYMHTMGNSGGGLQLYTDLEKYPEYQGGFIWDFIDQAIYKTLPNGSEFLSYGGDWHDRPSDYEFCGNGIVFADRTLTPKLQTVKHLYSNIKIAVDEKSVTIKNDNLFEDLSAYTFLARVYEDGRKVSESEYHFDVKPGEEATFPVNFVVEASNSEQIYEVACVLREATEWAPKGHEIVRGQYVVEKISTETPVKAPLNVVEGDFNIGIQGQNFSILLSRAQNTLVSAKYNGVEFIEKGPKLSFTRAYTDNDRGAGYPFEMAGWKVAGNYSKVTDTQIQIEDDSVKVTYVHELPGLSDVEVKVTYQVDYKGRIFVTANYDGKAGLPNFPEFGLEFAIGSQFTNLSYYGYGAEESYRDKLPGAYLGRYETSVEKTFAPYLMPQESGNHYGTREFTVSDDNHNGLKFTALNKAFEFSALRNSTEQIENARHQYELQESDATWIKVLAAQMGVGGDDTW	1026	Nucleic Acid	Natural	It increases the number of CD80+CD11c+and CD86+CD11c+ dendritic cells and CD4+CD25+ regulatory T cells and also induces the production of IL-6.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice	Spleenocytes	LRR	Q99MB1.fasta	Q99MB1	905	It is a potent stimulators of innate immunity.	ELISA	20163626	2010	Pubchem Assay
PRRID_0691	MsST Click for more detail	Streptococcus thermophilus lacZ (Bacteria)	MNMTEKIQTYLNDPKIVSVNTVDAHSDHKYFESLEEFSEGEMKLRQSLNGKWKIHYAQNTNQVLKDFYKTEFDETDLNFINVPGHLELQGFGSPQYVNTQYPWDGKEFLRPPQVPQESNAVASYVKHFTLNDALKDKKVFISFQGVATSIFVWVNGNFVGYSEDSFTPSEFEISDYLVEGDNKLAVAVYRYSTASWLEDQDFWRLYGIFRDVYLYAIPKVHVQDLFVKGDYDYQTKAGQLDIDLKTVGDYEDKKIKYVLSDYEGIVTEGDASVNGDGELSVSLENLKIKPWSAESPKLYDLILHVLDDDQVVEVVPVKVGFRRFEIKDKLMLLNGKRIVFKGVNRHEFNARTGRCITEEDMLWDIKVMKQHNINAVRTSHYPNQTRWYELCDEYGLYVIDEANLETHGTWQKLGLCEPSWNIPASEPEWLPACLDRANNMFQRDKNHASVIIWSCGNESYAGKDIADMADYFRSVDNTRPVHYEGVAWCREFDYITDIESRMYAKPADIEEYLTTGKLVDLSSVSDKHFASGNLTNKPQKPYISCEYMHTMGNSGGGLQLYTDLEKYPEYQGGFIWDFIDQAIYKTLPNGSEFLSYGGDWHDRPSDYEFCGNGIVFADRTLTPKLQTVKHLYSNIKIAVDEKSVTIKNDNLFEDLSAYTFLARVYEDGRKVSESEYHFDVKPGEEATFPVNFVVEASNSEQIYEVACVLREATEWAPKGHEIVRGQYVVEKISTETPVKAPLNVVEGDFNIGIQGQNFSILLSRAQNTLVSAKYNGVEFIEKGPKLSFTRAYTDNDRGAGYPFEMAGWKVAGNYSKVTDTQIQIEDDSVKVTYVHELPGLSDVEVKVTYQVDYKGRIFVTANYDGKAGLPNFPEFGLEFAIGSQFTNLSYYGYGAEESYRDKLPGAYLGRYETSVEKTFAPYLMPQESGNHYGTREFTVSDDNHNGLKFTALNKAFEFSALRNSTEQIENARHQYELQESDATWIKVLAAQMGVGGDDTW	1026	Nucleic Acid	Natural	It increases the number of CD80+CD11c+and CD86+CD11c+ dendritic cells and CD4+CD25+ regulatory T cells and also induces the production of IL-6.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice	Spleenocytes	LRR	Q99MB1.fasta	Q99MB1	905	It is a potent stimulators of innate immunity.	ELISA	20163626	2010	Pubchem Assay
PRRID_0694	muramyl dipeptide (MDP) + LPS + Poly(I:C) Click for more detail	Bacteria	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Peptide	Natural	It help in NF	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	C57BL/6 Mice	liver and Hepatocytes	NA	Q3UP24.fasta	Q3UP24	1024	It plays an important regulatory role in many inflammatory processes involving the liver.	Immunoblotting and EMSA	20615568	2010	Pubchem Assay
PRRID_0694	muramyl dipeptide (MDP) + LPS + Poly(I:C) Click for more detail	Bacteria	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Peptide	Natural	It help in NF	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	C57BL/6 Mice	liver and Hepatocytes	NA	Q3UP24.fasta	Q3UP24	1024	It plays an important regulatory role in many inflammatory processes involving the liver.	Immunoblotting and EMSA	20615568	2010	Pubchem Assay
PRRID_0696	mutated SOD1 Click for more detail	exogenous (others)	NA	NA	Protein	Synthetic	NA	Toll-like receptor 14 (TLR14)	Toll-like receptor (TLR)	Mice	microglia	NA	P10810.fasta	P10810	366	activation and toxicity of microglia	NA	20706642	2010	Pubchem Assay
PRRID_0696	mutated SOD1 Click for more detail	exogenous (others)	NA	NA	Protein	Synthetic	NA	Toll-like receptor 14 (TLR14)	Toll-like receptor (TLR)	Mice	microglia	NA	P10810.fasta	P10810	366	activation and toxicity of microglia	NA	20706642	2010	Pubchem Assay

previous 1 2 345 6 7 8 9...28 29 next