| Primary information |
|---|
| PRRID | PRRID_0561 |
| Ligand Name | HMGB1 |
| Source | Mouse model of endotoxemia |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Acts as a mediator of inflammation and organ damage |
| Name of receptor | RAGE |
| Type of receptor | Receptor for advanced glycation endproducts (RAGE) |
| Source | Mice |
| Localization | NA |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q62151.fasta |
| Swiss prot ID | Q62151 |
| Length Of Receptor | 402 |
| Function | Acts as a mediator of inflammation and organ damage |
| Assay used | NA |
| PMID | 20740341 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0561 |
| Ligand Name | HMGB1 |
| Source | Mouse model of endotoxemia |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Acts as a mediator of inflammation and organ damage |
| Name of receptor | RAGE |
| Type of receptor | Receptor for advanced glycation endproducts (RAGE) |
| Source | Mice |
| Localization | NA |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q62151.fasta |
| Swiss prot ID | Q62151 |
| Length Of Receptor | 402 |
| Function | Acts as a mediator of inflammation and organ damage |
| Assay used | NA |
| PMID | 20740341 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |