| Primary information |
|---|
| PRRID | PRRID_0690 |
| Ligand Name | Mrp8 |
| Source | Mice (others) |
| Sequence of ligand | MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE |
| Length | 89 |
| Type | Damage-associated molecular patterns (DAMPs) |
| Occurence | Natural |
| Role of Ligand | Binding leads to the secretion of the IL-17 |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | Leukocytes and endothelial cells |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | It promotes the inflammation and might be involved in the progression of inflammation during CD40L-induced autoimmunity. It is also crucial for the devlopment of CD8+ T cells |
| Assay used | ELISA |
| PMID | 20473308 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0690 |
| Ligand Name | Mrp8 |
| Source | Mice (others) |
| Sequence of ligand | MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE |
| Length | 89 |
| Type | Damage-associated molecular patterns (DAMPs) |
| Occurence | Natural |
| Role of Ligand | Binding leads to the secretion of the IL-17 |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | Leukocytes and endothelial cells |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | It promotes the inflammation and might be involved in the progression of inflammation during CD40L-induced autoimmunity. It is also crucial for the devlopment of CD8+ T cells |
| Assay used | ELISA |
| PMID | 20473308 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |