| Primary information |
|---|
| PRRID | PRRID_0563 |
| Ligand Name | HMGB1 |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Epinephrine directly acts through Mφ β- adrenergic receptor to stimulate HMGB1 secretion from the Mφ in an autocrine manner |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | lung |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | NA |
| Assay used | NA |
| PMID | 20706658 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0563 |
| Ligand Name | HMGB1 |
| Source | Host (Endogenous) (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Epinephrine directly acts through Mφ β- adrenergic receptor to stimulate HMGB1 secretion from the Mφ in an autocrine manner |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | lung |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | NA |
| Assay used | NA |
| PMID | 20706658 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |